DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk7 and Cdk5

DIOPT Version :9

Sequence 1:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster


Alignment Length:293 Identity:121/293 - (41%)
Similarity:181/293 - (61%) Gaps:11/293 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ERYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQHENI 74
            ::|.|:..:|||.:.||:|.|:..|.:|||:|:::   .::..:|:..:|||||.:|:||:|:||
  Fly     2 QKYDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVR---LDEDDEGVPSSALREICLLKELKHKNI 63

  Fly    75 IGLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKIILTQANIKAYAIMTLKGLEYLHLNWILHRDLK 139
            :.|:||......::|||:..|.||:.........:..|..:::.:..|:||.:.|.:.:||||||
  Fly    64 VRLIDVLHSDKKLTLVFEHCDQDLKKYFDSLNGEIDMAVCRSFMLQLLRGLAFCHSHNVLHRDLK 128

  Fly   140 PNNLLVNSDGILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGVDMWAVGCILA 204
            |.|||:|.:|.||:.|||||::||.|.:.|:..|||.|||.|::||||:.|.|.:|||:.|||||
  Fly   129 PQNLLINKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGCILA 193

  Fly   205 ELM-LRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDYLQFRNFPG----TPLDNIFTAA 264
            ||. ...|..||...||||.:||..||||.|..||.:|.|.||:...:||.    :.|.....:.
  Fly   194 ELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDYVALPSFPAITSWSQLVPRLNSK 258

  Fly   265 GNDLIHLMQRLFAMNPLRRVSCREALSMPYFAN 297
            |.|   |:|:|....|.:|:|...|:..|||.:
  Fly   259 GRD---LLQKLLICRPNQRISAEAAMQHPYFTD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 121/293 (41%)
STKc_CDK7 11..308 CDD:270833 121/292 (41%)
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 121/291 (42%)
STKc_CDK5 3..286 CDD:143344 119/288 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.