DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk7 and Cdk20

DIOPT Version :9

Sequence 1:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001020923.2 Gene:Cdk20 / 364666 RGDID:1305219 Length:346 Species:Rattus norvegicus


Alignment Length:306 Identity:129/306 - (42%)
Similarity:188/306 - (61%) Gaps:9/306 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ERYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQ-HEN 73
            ::|..|..:|||....|:||:...|.:|||:||:.....|   |||...||||||.|||:: .:.
  Rat     2 DQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLE---DGIPNQALREIKALQEIEDSQY 63

  Fly    74 IIGLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKIILTQANIKAYAIMTLKGLEYLHLNWILHRDL 138
            ::.|..||...:...|.|:||.:||..:::..:..|..|.:|:|..|.|||:.:.|.|.|:||||
  Rat    64 VVQLKAVFPHGAGFVLAFEFMLSDLAEVVRHAQRPLAPAQVKSYLQMLLKGVAFCHANNIVHRDL 128

  Fly   139 KPNNLLVNSDGILKIGDFGLAKSFGSPN--RIYTHHVVTRWYRSPELLFGARQYGTGVDMWAVGC 201
            ||.|||:::.|.|||.|||||:.| ||:  |:|||.|.|||||:||||:|||||..|||:|||||
  Rat   129 KPANLLISASGQLKIADFGLARVF-SPDGGRLYTHQVATRWYRAPELLYGARQYDQGVDLWAVGC 192

  Fly   202 ILAELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDY--LQFRNFPGTPLDNIFTAA 264
            |:.||:...|..||::|::||..:...||||:...||.:::|.||  :.|:.....||:.:...|
  Rat   193 IMGELLNGSPLFPGENDIEQLCCVLRILGTPSPRVWPEITELPDYNKISFKEQAPVPLEEVLPDA 257

  Fly   265 GNDLIHLMQRLFAMNPLRRVSCREALSMPYFANKPAPTVGPKLPMP 310
            .:..:.|:.:.....|.:|::..:||...||...|.|....:||:|
  Rat   258 SHQALDLLGQFLLYPPRQRIAASQALLHQYFFTAPLPAHPSELPIP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 126/302 (42%)
STKc_CDK7 11..308 CDD:270833 126/301 (42%)
Cdk20NP_001020923.2 STKc_CCRK 3..289 CDD:270826 123/289 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..324 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0659
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1367115at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.