DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk7 and Cdk2

DIOPT Version :9

Sequence 1:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_006240840.1 Gene:Cdk2 / 362817 RGDID:70486 Length:346 Species:Rattus norvegicus


Alignment Length:353 Identity:127/353 - (35%)
Similarity:189/353 - (53%) Gaps:73/353 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ERYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQHENI 74
            |.:.|:..:|||.:..||||::.:|.::||:|||:   .:...:|:..||:|||.:|:||.|.||
  Rat     2 ENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIR---LDTETEGVPSTAIREISLLKELNHPNI 63

  Fly    75 IGLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKII-LTQANIKAYAIMTLKGLEYLHLNWILHRDL 138
            :.|:||....:.:.|||:|:..||:..:..:.:. :....||:|....|:||.:.|.:.:|||||
  Rat    64 VKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDL 128

  Fly   139 KPNNLLVNSDGILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGVDMWAVGCIL 203
            ||.|||:|::|.:|:.|||||::||.|.|.|||.|||.|||:||:|.|.:.|.|.||:|::|||.
  Rat   129 KPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIF 193

  Fly   204 AELML------------------------------------------------RVPFMPGDSDLD 220
            ||:.|                                                |....||||::|
  Rat   194 AEMHLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVSTPYPVTRRALFPGDSEID 258

  Fly   221 QLTRIFSTLGTPTEAEWPHLSKLHDYLQFRNFPG----------TPLDNIFTAAGNDLIHLMQRL 275
            ||.|||.|||||.|..||.::.:.||..  :||.          .|||       .|...|:.::
  Rat   259 QLFRIFRTLGTPDEVVWPGVTSMPDYKP--SFPKWARQDFSKVVPPLD-------EDGRSLLSQM 314

  Fly   276 FAMNPLRRVSCREALSMPYF--ANKPAP 301
            ...:|.:|:|.:.||:.|:|  ..||.|
  Rat   315 LHYDPNKRISAKAALAHPFFQDVTKPVP 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 127/353 (36%)
STKc_CDK7 11..308 CDD:270833 126/352 (36%)
Cdk2XP_006240840.1 STKc_CDK2_3 3..334 CDD:270844 122/342 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.