DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk7 and CDKL4

DIOPT Version :9

Sequence 1:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001333840.1 Gene:CDKL4 / 344387 HGNCID:19287 Length:379 Species:Homo sapiens


Alignment Length:352 Identity:120/352 - (34%)
Similarity:184/352 - (52%) Gaps:33/352 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ERYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQHENI 74
            |:|.||:..|||.:..|:|.|:..:.|:|||||..:...:..   :.:.|||||::|::|:|.|:
Human     2 EKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPV---VKKIALREIRMLKQLKHPNL 63

  Fly    75 IGLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKIILTQANIKAYAIMTLKGLEYLHLNWILHRDLK 139
            :.|::||.:...:.|||::.|..|...::.|...:....||:....||:.|.:.|::..:|||:|
Human    64 VNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVADGVIKSVLWQTLQALNFCHIHNCIHRDIK 128

  Fly   140 PNNLLVNSDGILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGVDMWAVGCILA 204
            |.|:|:...||:||.|||.|:.. .|...||.:|.|||||:||||.|..|||:.||:||:||:.|
Human   129 PENILITKQGIIKICDFGFAQIL-IPGDAYTDYVATRWYRAPELLVGDTQYGSSVDIWAIGCVFA 192

  Fly   205 ELMLRVPFMPGDSDLDQLTRIFSTLG--TPTEAEWPHLSKLHDYLQFRNFPG----TPLDNIFTA 263
            ||:...|..||.||:|||..|..|||  .|....   :.|.:.:....:.|.    ..|:..|:.
Human   193 ELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQS---IFKSNGFFHGISIPEPEDMETLEEKFSD 254

  Fly   264 AGNDLIHLMQRLFAMNPLRRVSCREALSMPYFANKPAPTVGPKLPMPSAILAAKEGAN------- 321
            .....::.|:....|||..|::|.:.|...||.:.....:..|        |..||.|       
Human   255 VHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQIKRK--------ARNEGRNRRRQQQA 311

  Fly   322 PQTGDTKPALKRKLV-----ETTVRGN 343
            |::...:..||.|:.     ||...||
Human   312 PKSAFPRLFLKTKICQVQRNETQTSGN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 108/303 (36%)
STKc_CDK7 11..308 CDD:270833 107/302 (35%)
CDKL4NP_001333840.1 [NKR]KIAxRE 45..51 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.