DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk7 and cdc2

DIOPT Version :9

Sequence 1:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001342995.1 Gene:cdc2 / 2539869 PomBaseID:SPBC11B10.09 Length:297 Species:Schizosaccharomyces pombe


Alignment Length:296 Identity:122/296 - (41%)
Similarity:180/296 - (60%) Gaps:16/296 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ERYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQHE-- 72
            |.|.|:..:|||.:..|||||..::.:|||:|||:   .||..:|:..||:|||.:|:|:..|  
pombe     2 ENYQKVEKIGEGTYGVVYKARHKLSGRIVAMKKIR---LEDESEGVPSTAIREISLLKEVNDENN 63

  Fly    73 --NIIGLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKIILTQAN------IKAYAIMTLKGLEYLH 129
              |.:.|:|:....|.:.|||:|:|.||:..:  ::|..|.|.      ::.:....:.|:.:.|
pombe    64 RSNCVRLLDILHAESKLYLVFEFLDMDLKKYM--DRISETGATSLDPRLVQKFTYQLVNGVNFCH 126

  Fly   130 LNWILHRDLKPNNLLVNSDGILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGV 194
            ...|:||||||.|||::.:|.||:.|||||:|||.|.|.|||.:||.|||:||:|.|:|.|.|||
pombe   127 SRRIIHRDLKPQNLLIDKEGNLKLADFGLARSFGVPLRNYTHEIVTLWYRAPEVLLGSRHYSTGV 191

  Fly   195 DMWAVGCILAELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDYLQ-FRNFPGTPLD 258
            |:|:||||.||::.|.|..||||::|::.:||..||||.|..||.::.|.||.. |..:....|.
pombe   192 DIWSVGCIFAEMIRRSPLFPGDSEIDEIFKIFQVLGTPNEEVWPGVTLLQDYKSTFPRWKRMDLH 256

  Fly   259 NIFTAAGNDLIHLMQRLFAMNPLRRVSCREALSMPY 294
            .:......|.|.|:..:...:|..|:|.:.||...|
pombe   257 KVVPNGEEDAIELLSAMLVYDPAHRISAKRALQQNY 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 122/296 (41%)
STKc_CDK7 11..308 CDD:270833 121/295 (41%)
cdc2NP_001342995.1 STKc_CDK1_CdkB_like 4..293 CDD:270829 121/294 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.