DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rps6ka5 and S6k

DIOPT Version :9

Sequence 1:NP_001382521.1 Gene:Rps6ka5 / 314384 RGDID:1308336 Length:798 Species:Rattus norvegicus
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:364 Identity:185/364 - (50%)
Similarity:246/364 - (67%) Gaps:14/364 - (3%)


- Green bases have known domain annotations that are detailed below.


  Rat    21 GEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYGKVFLVRKISGHDAGKLYAMKVLKKA 85
            |::.:.:..|    |:.....|:|.::|||.||||.|.|||||.|||.:|.||.|.:||||||||
  Fly    54 GQETIQLCEE----NVNPGKIKLGPKDFELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKA 114

  Rat    86 TIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELFTHLSQRERFTE 150
            :||...|.|.|||.||.:||.::. ||:|.|.|||||:.||:|||:|::|||||.||.:...|.|
  Fly   115 SIVTNQKDTAHTRAERNILEAVKH-PFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLE 178

  Rat   151 HEVQIYVGEIVLALEHLHKLGIIYRDIKLENILLDSNGHVVLTDFGLSKEFVADEAERAYSFCGT 215
            .....|:.||:|||.|||||||||||:|.||||||:.|||.||||||.||.: .|....::||||
  Fly   179 DTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHI-QEGIVTHTFCGT 242

  Rat   216 IEYMAPDIVRGGDSGHDKAVDWWSLGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQG 280
            ||||||:|:.  .|||.|||||||||.||:::|||..|||.:..|.:    ...|||::...|..
  Fly   243 IEYMAPEILT--RSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKKT----IETILKAKLNLPAY 301

  Rat   281 MSSVAKDLLQRLLMKDPKKRLGCGPRDAEEIKEHLFFEKINWDDLAAKKVPAPFKPVIRDELDVS 345
            ::..|:||::||:.:...:|||.||.||..::.|.||:.:||||:.|:::..|.||::|.|.|||
  Fly   302 LTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVS 366

  Rat   346 NFAEEFTEMDPTYSP--AALPQSSERLFQGYSFVAPSIL 382
            .|...||...|..||  ..|.:|:..:|||:::||||||
  Fly   367 QFDTRFTRQIPVDSPDDTTLSESANLIFQGFTYVAPSIL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rps6ka5NP_001382521.1 None
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 173/328 (53%)
STKc_p70S6K 81..402 CDD:270736 172/328 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334261
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1132245at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.