DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42749 and CG42598

DIOPT Version :9

Sequence 1:NP_001188545.1 Gene:CG42749 / 31438 FlyBaseID:FBgn0261803 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001163857.2 Gene:CG42598 / 8674042 FlyBaseID:FBgn0260997 Length:340 Species:Drosophila melanogaster


Alignment Length:261 Identity:102/261 - (39%)
Similarity:137/261 - (52%) Gaps:40/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTAATMGVLLPVGVLGFVVLMQLMASVRGHGRLMDPPARNAMWRFGYPNPVNYNDNELFCGGYAV 70
            :|...|..::...:..|........|..|||||::||.|.:.||||:..|.:|||:||.|||.:.
  Fly     1 MTGTNMVFVIKWYIAFFFAASIFAMSCNGHGRLVEPPGRASAWRFGFQTPPDYNDHELNCGGLSR 65

  Fly    71 QWEQNKGRCGICGDAYHVKSPRPHEAGGQYAKGIISRYYTAGQTIDVEVELTANHYGRFEMFLCP 135
            ||::|.|:||.||||:.:..|||||.||.:.||.|.|.|..|..:.:.|||||:|.|.||..:||
  Fly    66 QWQRNGGKCGECGDAWDLPEPRPHEYGGHWGKGQIVRSYLPGSQMTIRVELTASHMGYFEFRICP 130

  Fly   136 NNNPRQEATQQCFDRYPL-LISGSREHRYLIPRDAKKKD------------IFRYKVRLPPYVTC 187
            |.|    |.|.|.|...| :::||       |....:.|            |:....:||.: ||
  Fly   131 NPN----AKQSCLDENVLSILNGS-------PSQPNESDLDTRFYPRNGSCIYEILAQLPDF-TC 183

  Fly   188 TQCVLQWTYYTANMWGTCANGTEAVGCGKAETFRNCADVAIVS----------NTGGGIPPPFVN 242
            ..|||||.|...|.||.|.||..|:|||..|.||:|:|:|:.:          |     |||..:
  Fly   184 EHCVLQWRYVAGNNWGMCGNGIGAIGCGPQEEFRSCSDIALTTEYLHPYLSPIN-----PPPSQS 243

  Fly   243 N 243
            |
  Fly   244 N 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42749NP_001188545.1 Chitin_bind_3 35..226 CDD:281112 90/203 (44%)
CG42598NP_001163857.2 Chitin_bind_3 30..222 CDD:281112 90/203 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283095at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.