DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42749 and CG4362

DIOPT Version :9

Sequence 1:NP_001188545.1 Gene:CG42749 / 31438 FlyBaseID:FBgn0261803 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_650876.1 Gene:CG4362 / 42410 FlyBaseID:FBgn0038784 Length:233 Species:Drosophila melanogaster


Alignment Length:251 Identity:105/251 - (41%)
Similarity:138/251 - (54%) Gaps:41/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MRHLTAATMGVLLPVGVLGFVVLMQLMASVRGHGRLMDPPARNAMWRFGYPNPVNYNDNELFCGG 67
            |::|.:.|:  ||.:|      |.|:.|    ||.::.||:|::.||:....|.|:|||||||||
  Fly     1 MKYLLSMTL--LLAIG------LQQIDA----HGMMLSPPSRSSRWRYDGSAPQNWNDNELFCGG 53

  Fly    68 YAVQWEQNKGRCGICGDAYHVKSPRPHEAGGQY-AKGIISRYYTAGQTIDVEVELTANHYGRFEM 131
            ...| ..|.||||:|||.:....||.:|.||.. ..|:::|.|.||.||.|.|::|.||.|.||.
  Fly    54 LYTQ-SNNGGRCGLCGDNFLDAQPRANEIGGSIGGAGVVTRSYVAGNTITVGVKITTNHLGYFEF 117

  Fly   132 FLCPNNNPRQEATQQCFDRYPL-LISGSREHRYLIPRDAKKKDI------FRYKVRLPPYVTCTQ 189
            .|| |.:.....:::|||:..| .|.||           .:|||      |...|.||..:||:.
  Fly   118 HLC-NLDAFGAESEECFDQNRLRFIDGS-----------DRKDIGDQMGEFDVTVVLPEGLTCSH 170

  Fly   190 CVLQWTYYTANMWGTCAN-GTEAVGCGKAETFRNCADVAIV-------SNTGGGIP 237
            |||:|||..||.||.|.| |..|:|||..|||:|||||:|.       ...|||.|
  Fly   171 CVLRWTYVGANNWGICDNSGNGALGCGPQETFKNCADVSIYWGRNLVKELVGGGDP 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42749NP_001188545.1 Chitin_bind_3 35..226 CDD:281112 89/199 (45%)
CG4362NP_650876.1 Chitin_bind_3 21..208 CDD:281112 89/199 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447025
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28MU0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283095at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.