DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5062 and CG11449

DIOPT Version :9

Sequence 1:NP_572207.1 Gene:CG5062 / 31435 FlyBaseID:FBgn0029747 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_649390.1 Gene:CG11449 / 40467 FlyBaseID:FBgn0037162 Length:538 Species:Drosophila melanogaster


Alignment Length:512 Identity:130/512 - (25%)
Similarity:241/512 - (47%) Gaps:42/512 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RARKYDGA---KATFFHIKGQSW---------ESKGYAELSQCELDRMRASRPRTTEER----RA 138
            |||....|   .|..||....|:         :|..|   .|.:|.|....|.|....:    ||
  Fly    28 RARAQTAAYRPPACGFHPTATSFGSFRRPLCDQSAAY---DQKQLKRNERDRKRNQGTKQVVLRA 89

  Fly   139 EQDRRMEEQQYHTAEAERMRNYFHDIDEQRR-----EKEREAQKRDDDEADEDVNEDRRA----- 193
            .:.||:::|......:|:::......:|.|:     |:.|:..|..|:......:|.|..     
  Fly    90 GELRRLKDQGKLETVSEKLQRIEQHEEEHRKQLQMVEETRQRFKAIDEAKGVGASESRSTLLSEI 154

  Fly   194 -EAKRLQVLHRALDAKYESDVRVKDATRAISEAKCSAMWTAQIQERKLLNRIQLDHDEEMARKNR 257
             |.|. .||.||..|:.|.:..||...|.|.:|||.|:..|||.|:.||::...:.||.:||...
  Fly   155 LEEKE-SVLSRAFLARQEQEQEVKQINRMILDAKCKAVREAQIHEKHLLSKALREDDERLARMVN 218

  Fly   258 DYNNAKWGTVEQQDQAEEERRRQFGNAVREQITDREKLRFLAQDRLRLEARDLRAAVDEYKKAEL 322
            :.........:::::.|.|:|.::...:|:|:::||.:|:|...|:..||:|:|.|.:..:..|.
  Fly   219 ERAQKALTEEDERERLEVEKRNRYAQEIRQQLSERENVRYLEAKRVADEAKDIRRATELLRSQEE 283

  Fly   323 AEGEMKSRRKLAYRDELNKYTKLHRNFVRMMCEQDQRDENRAYEYLKLKEQQLKQQRAEREAIAA 387
            .:......||...|:||.:...:...|..|..||::..:.|...|::.|:::.:|.:..:.....
  Fly   284 QQRAFAQLRKQRLREELQRIRDMSNVFKTMFSEQERLADLRVTAYMRDKQEKERQLKEMKRLAKK 348

  Fly   388 DEKRKRDVLFAVGQKILDAKDNREEMHFLAEHERLERKYRENERKAAEKERKMAAELKRANMEQM 452
            :.:|::..:|.|..:.::.:...:|:.:|.|.:|:||:||:.|::||...|:...:|..|..:|.
  Fly   349 EFERRQQRIFTVAAEAMETRQTNDELKYLKERDRVEREYRQREKEAAIARREAERDLLEARAQQA 413

  Fly   453 EHLSQMKACFYVQRERELKEMIEYRKKHEEQMK-----REAEEQAIKKACLRSSVSCQIEEREKA 512
            :.:.|..|........|..::::..::.||:.|     |:|:.||     .|..:..|:.:::..
  Fly   414 QEMKQRLALEIAHAGEEFAKVMDRMREEEEKQKVMDRQRDAQRQA-----YRQDLRQQMTDKQAE 473

  Fly   513 RRRELEEEHLAFERERAAEAQRQKEIDTVITVKLDDLQKRGCLPNLAVQSLKGRVAN 569
            |||..|.|....::....|.||...|..||..|:..: :..|||...::.::.::.|
  Fly   474 RRRLAELEAGRVQKWLDHEKQRDVNIQQVINAKIAAM-RDNCLPEKYLREVEKQLKN 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5062NP_572207.1 TPH 214..554 CDD:290579 89/344 (26%)
CG11449NP_649390.1 TPH 172..517 CDD:290579 91/350 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C0KR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007075
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15504
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.