DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn13R and RPN13

DIOPT Version :9

Sequence 1:NP_572205.1 Gene:Rpn13R / 31433 FlyBaseID:FBgn0029745 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_013525.3 Gene:RPN13 / 851140 SGDID:S000004413 Length:156 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:24/81 - (29%)
Similarity:39/81 - (48%) Gaps:14/81 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ELD---IVATPGVLEFRRIDQCKTGRVYVLKYTRSTQRYFFWMQ----------ELQADGDALFC 108
            |||   ::..||...:..|...|:||::.|.:: |.:|||||:|          ||.|....::.
Yeast    60 ELDPISLILIPGETMWVPIKSSKSGRIFALVFS-SNERYFFWLQEKNSGNLPLNELSAKDKEIYN 123

  Fly   109 QRVNELIASGERQRDE 124
            :.:..|..|.|...:|
Yeast   124 KMIGVLNNSSESDEEE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn13RNP_572205.1 PH_Rpn13 10..115 CDD:270124 20/70 (29%)
RPN13_C 204..312 CDD:293158
RPN13NP_013525.3 Proteasom_Rpn13 13..103 CDD:398384 16/43 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344150
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3037
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102724
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.730

Return to query results.
Submit another query.