DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn13R and ADRM1

DIOPT Version :9

Sequence 1:NP_572205.1 Gene:Rpn13R / 31433 FlyBaseID:FBgn0029745 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_024307582.1 Gene:ADRM1 / 11047 HGNCID:15759 Length:470 Species:Homo sapiens


Alignment Length:450 Identity:115/450 - (25%)
Similarity:183/450 - (40%) Gaps:147/450 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNAHNLVEYKAGRMVLLGKMVEPDDRKGLLFVRRSADDNQLHIHWMDRRSGSVELDIVATPGVLE 68
            ||.: |||::||:|.|.|..|.||.||||:::::: ||:.:|..|.||.||:||.|::..|...|
Human    19 SNKY-LVEFRAGKMSLKGTTVTPDKRKGLVYIQQT-DDSLIHFCWKDRTSGNVEDDLIIFPDDCE 81

  Fly    69 FRRIDQCKTGRVYVLKYTRSTQRYFFWMQELQADGDALFCQRVNELI----------ASGERQRD 123
            |:|:.||.:|||||||:...::|.||||||.:.|.|...|::|||.:          |||. ...
Human    82 FKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGASGS-SGH 145

  Fly   124 EIAA--AEGDMDT---DADHTTARR-----------GFGGSENPQILEEMLVETQATWLPANRSL 172
            |::|  .||.:.:   :..|:...:           |.|....|.:...:    .::..|.:.|.
Human   146 ELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLL----GSSGPPGSSSS 206

  Fly   173 NHWQTGDAMEEP----------PLPFADPDANTDTDTDTYTSESG----------IQTFDLAAVL 217
            :..::..|...|          |.|.|...|:..:.:...:|.:|          ||..||.::|
Human   207 SSSRSQSAAVTPSSTTSSTRATPAPSAPAAASATSPSPAPSSGNGASTAASPTQPIQLSDLQSIL 271

  Fly   218 RL-------HGAEAVD-----------KVLSCPSRREKLMAQLPKDHEAMDEQSDILE------- 257
            ..       .|.:.||           .:|:....:|:|:..||.. |::.:.:|.::       
Human   272 ATMNVPAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSG-ESLPQTADEIQNTLTSPQ 335

  Fly   258 -----------------------------------HLHSAQ----------------------FY 265
                                               |:...|                      |.
Human   336 FQQVEAGPRVSSTVCSGSGQGGGGGPAPPSPWPVLHVPDPQSWQLSSVALGCSPGWSSALAWLFL 400

  Fly   266 ESLSSFSVGLHSGALRKSLEPLL-QSDDNREALNAAQVGDVERFLRELERN------DGD 318
            ::|..||..|.||    .|.||: |.....||:.||..||||.|.:.::.|      :||
Human   401 QALGMFSAALASG----QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGD 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn13RNP_572205.1 PH_Rpn13 10..115 CDD:270124 51/104 (49%)
RPN13_C 204..312 CDD:293158 39/200 (20%)
ADRM1XP_024307582.1 PH_Rpn13 24..128 CDD:270124 51/104 (49%)
RPN13_C 274..444 CDD:318700 32/174 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148053
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1479349at2759
OrthoFinder 1 1.000 - - FOG0003818
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102724
Panther 1 1.100 - - O PTHR12225
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2662
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.