DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32767 and NUC

DIOPT Version :9

Sequence 1:NP_001162674.1 Gene:CG32767 / 31430 FlyBaseID:FBgn0052767 Length:1281 Species:Drosophila melanogaster
Sequence 2:NP_199229.1 Gene:NUC / 834439 AraportID:AT5G44160 Length:466 Species:Arabidopsis thaliana


Alignment Length:589 Identity:117/589 - (19%)
Similarity:185/589 - (31%) Gaps:196/589 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 SASGSSSTNNNSTTNSTNSNNNTP----------------------AATATVTTSYQCVECVEKF 518
            |.||.:...::||.:...|..|.|                      ..|...|..:.|..|.:.|
plant    11 SGSGFAQPQSSSTLDHDESLINPPLVKKKRNLPGNPDPEAEVIALSPTTLMATNRFLCEVCGKGF 75

  Fly   519 DSKELFDIHRSGHANNMKCAICNMVLKSLKNYEKHCLRCKPYEC--QICGRVVRFRPNFIKHMRV 581
            ...:...:||.||         |:..| ||......:|.:.|.|  :.|          :.|   
plant    76 QRDQNLQLHRRGH---------NLPWK-LKQRTSKEVRKRVYVCPEKTC----------VHH--- 117

  Fly   582 HTGQQ-SERHKYKCEVCHKEFMSFEYFKVHKKIHNENVNLTCEICGKVFSALASLRGHSKLHSGV 645
            |:.:. .:....|...|.|              |.|. ..|||.|.|.::..:..:.|||. .|.
plant   118 HSSRALGDLTGIKKHFCRK--------------HGEK-KWTCEKCAKRYAVQSDWKAHSKT-CGT 166

  Fly   646 KLHKCDVCGKGFGQRYNLKIHARTHTGDFPFECKICKKKLHTQSSLQTHMQVHLRDQPGAAAAAA 710
            :.::|| ||..|.:|                            .|..||          .|...|
plant   167 REYRCD-CGTIFSRR----------------------------DSFITH----------RAFCDA 192

  Fly   711 TAAGAASSKASNSSNSSNSSNSSSSNSSSNGVSAAVSAATTT--------TTIVKLEPPHEIERP 767
            .|...|...|.               |..||::||.:..:..        |.|..|:|  .:.:|
plant   193 LAEETAKINAV---------------SHLNGLAAAGAPGSVNLNYQYLMGTFIPPLQP--FVPQP 240

  Fly   768 GTSSNQQLQQSQHHQ-MELDDQSGLS------------GDEEDGSGGGMNSSSHIVNATTNRLTT 819
            .|:.|      .||| .:....|.||            ..:.|...|...::|..::   |..|.
plant   241 QTNPN------HHHQHFQPPTSSSLSLWMGQDIAPPQPQPDYDWVFGNAKAASACID---NNNTH 296

  Fly   820 GEDSSESSNASLHLNQHSSTSSSPASQHQVSSHQQHVHQQQQQQQQSQQQYLVSAPTRTIVIKNY 884
            .|..::::||||   ..::|.|:|:.          ....|.|...:.....:||   |.:::..
plant   297 DEQITQNANASL---TTTTTLSAPSL----------FSSDQPQNANANSNVNMSA---TALLQKA 345

  Fly   885 MQQGSQQQQQQQQQQQHTSDPTPVLHAQVIQSGAGTSN-----------GSGNTSSTNSSSNSST 938
            .:.|:.......     |:||:..|.:..::|...|::           ||.|.....|.|:...
plant   346 AEIGATSTTTAA-----TNDPSTFLQSFPLKSTDQTTSYDSGEKFFALFGSNNNIGLMSRSHDHQ 405

  Fly   939 NIVTTNAGGNLSNGSQL--IRKTPIIHHSTGSSNGSGGSALTSVVQQTGVISPAQSPSSSSTSCS 1001
            .|  .||..:::..|.|  ::..|............||...|......||          .|.|.
plant   406 EI--ENARNDVTVASALDELQNYPWKRRRVDGGGEVGGGGQTRDFLGVGV----------QTLCH 458

  Fly  1002 SSTV 1005
            .|::
plant   459 PSSI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32767NP_001162674.1 C2H2 Zn finger 537..557 CDD:275368 4/19 (21%)
C2H2 Zn finger 562..582 CDD:275368 3/21 (14%)
C2H2 Zn finger 594..614 CDD:275368 2/19 (11%)
C2H2 Zn finger 622..642 CDD:275368 7/19 (37%)
zf-C2H2 648..670 CDD:278523 6/21 (29%)
C2H2 Zn finger 650..670 CDD:275368 6/19 (32%)
zf-H2C2_2 662..684 CDD:290200 0/21 (0%)
C2H2 Zn finger 678..698 CDD:275368 3/19 (16%)
NUCNP_199229.1 C2H2 Zn finger 68..88 CDD:275368 5/19 (26%)
C2H2 Zn finger 109..137 CDD:275368 7/54 (13%)
C2H2 Zn finger 144..163 CDD:275368 6/18 (33%)
C2H2 Zn finger 171..187 CDD:275368 9/54 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.