DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32767 and ZNF71

DIOPT Version :9

Sequence 1:NP_001162674.1 Gene:CG32767 / 31430 FlyBaseID:FBgn0052767 Length:1281 Species:Drosophila melanogaster
Sequence 2:NP_001357144.1 Gene:ZNF71 / 58491 HGNCID:13141 Length:549 Species:Homo sapiens


Alignment Length:393 Identity:97/393 - (24%)
Similarity:140/393 - (35%) Gaps:89/393 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 STNSNNNTPAATATVTTSYQCVECVEKFDSKELFDIHRSGHANNMKCAICNMVLKSLKNYEKHCL 555
            |:.|:.:.|........:|.|.||.:.|........|:..|...                     
Human   172 SSTSDLSKPPMPCEEKKTYDCSECGKAFSRSSSLIKHQRIHTGE--------------------- 215

  Fly   556 RCKPYECQICGRVVRFRPNFIKHMRVHTGQQSERHKYKCEVCHKEFMSFEYFKVHKKIHNENVNL 620
              ||:||..||:....|.:...|.|||||::    .|.|..|.|.|.......||::.|......
Human   216 --KPFECDTCGKHFIERSSLTIHQRVHTGEK----PYACGDCGKAFSQRMNLTVHQRTHTGEKPY 274

  Fly   621 TCEICGKVFSALASLRGHSKLHSGVKLHKCDVCGKGFGQRYNLKIHARTHTGDFPFECKICKKKL 685
            .|::|||.|...:||..|.::|:|.|.:.|..|||.|.|..:|.:|.|||||:.|:.|..|.:..
Human   275 VCDVCGKAFRKTSSLTQHERIHTGEKPYACGDCGKAFSQNMHLIVHQRTHTGEKPYVCPECGRAF 339

  Fly   686 HTQSSLQTHMQVHLRDQPGAAAAAATAAGAASSKASNSSNSSNSSNSSSSNSSSNGVSAAVSAAT 750
            .....|..|.:.|..::|.|......|...:||...:..|.:.                      
Human   340 SQNMHLTEHQRTHTGEKPYACKECGKAFNKSSSLTLHQRNHTG---------------------- 382

  Fly   751 TTTTIVKLEPPHEIERPGTSSNQQLQQSQHHQMELDDQSGLSGDE--EDGSGGGMNSS--SHIVN 811
                    |.|:.....|.:.:|.....||.:..:    |:...|  |.|.....|||  .|   
Human   383 --------EKPYVCGECGKAFSQSSYLIQHQRFHI----GVKPFECSECGKAFSKNSSLTQH--- 432

  Fly   812 ATTNRLTTGEDSSESSNASLHLNQHSSTSSSPASQHQVSSHQQHVHQQQQQ-------QQQSQQQ 869
               .|:.|||...|......|.     |..|....||:      ||..::.       :..||..
Human   433 ---QRIHTGEKPYECYICKKHF-----TGRSSLIVHQI------VHTGEKPYVCGECGKAFSQSA 483

  Fly   870 YLV 872
            ||:
Human   484 YLI 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32767NP_001162674.1 C2H2 Zn finger 537..557 CDD:275368 0/19 (0%)
C2H2 Zn finger 562..582 CDD:275368 6/19 (32%)
C2H2 Zn finger 594..614 CDD:275368 6/19 (32%)
C2H2 Zn finger 622..642 CDD:275368 8/19 (42%)
zf-C2H2 648..670 CDD:278523 9/21 (43%)
C2H2 Zn finger 650..670 CDD:275368 9/19 (47%)
zf-H2C2_2 662..684 CDD:290200 10/21 (48%)
C2H2 Zn finger 678..698 CDD:275368 4/19 (21%)
ZNF71NP_001357144.1 KRAB 13..54 CDD:334504
C2H2 Zn finger 168..184 CDD:275368 3/11 (27%)
COG5048 170..544 CDD:227381 97/393 (25%)
C2H2 Zn finger 192..212 CDD:275368 5/19 (26%)
C2H2 Zn finger 220..240 CDD:275368 6/19 (32%)
C2H2 Zn finger 248..268 CDD:275368 6/19 (32%)
C2H2 Zn finger 276..296 CDD:275368 8/19 (42%)
C2H2 Zn finger 304..324 CDD:275368 9/19 (47%)
C2H2 Zn finger 332..352 CDD:275368 4/19 (21%)
C2H2 Zn finger 360..380 CDD:275368 3/19 (16%)
C2H2 Zn finger 388..408 CDD:275368 4/19 (21%)
C2H2 Zn finger 416..436 CDD:275368 7/25 (28%)
C2H2 Zn finger 444..464 CDD:275368 5/30 (17%)
C2H2 Zn finger 472..492 CDD:275368 4/15 (27%)
C2H2 Zn finger 500..520 CDD:275368
C2H2 Zn finger 528..548 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.