DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32767 and ZNF692

DIOPT Version :9

Sequence 1:NP_001162674.1 Gene:CG32767 / 31430 FlyBaseID:FBgn0052767 Length:1281 Species:Drosophila melanogaster
Sequence 2:XP_011542525.1 Gene:ZNF692 / 55657 HGNCID:26049 Length:625 Species:Homo sapiens


Alignment Length:554 Identity:114/554 - (20%)
Similarity:175/554 - (31%) Gaps:204/554 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 GAATSSAAGGAATAGGGSQQLVQLP-------------AGSIVSTTTHRLSV-PV---------- 330
            |.....|||.||.||...||:...|             ||.:.:....::.| ||          
Human   178 GGRVLQAAGEAAAAGRAPQQVPHPPGRPHGAVVPPQGAAGLLPALAARQVPVGPVHFFRLCPLCS 242

  Fly   331 TEAALVQLQRRPVYISNAVGGL----TAGATYVRMPAAAVISRSPMTVLNVVQQALPATQLILQT 391
            .|.:||...|.|   ....|||    :||.|:...|:   :|.:|        ...|....:..|
Human   243 RECSLVPGLRGP---GGQDGGLVWECSAGHTFSWGPS---LSPTP--------SEAPKPASLPHT 293

  Fly   392 QQQQTPAAAAAEQQLALALEQQRQQQEQQAQQQRQQQQQQE------------------------ 432
            .::...:.|.:.|:|| .||.:..::.|:|:....:.....                        
Human   294 TRRSWCSEATSGQELA-DLESEHDERTQEARLPSSEPDAPRLLPSPVTCTPKEGETPPAPAALSS 357

  Fly   433 ------------QQRQQQQQQQQQQQQQAQQEQQRQQQQQLQQQQQQQQTHPVKHSASGSSSTNN 485
                        ..|.....:.:.|.|.::..|..||.:.|.....|.|:.|             
Human   358 PLAVPALSASSLSSRAPPPAEVRVQPQLSRTPQAAQQTEALASTGSQAQSAP------------- 409

  Fly   486 NSTTNSTNSNNNTPA---ATATVTTSYQCVECVEKFDSKELFDIHRSGHANNMKCAICNMVLKSL 547
                        |||   .||.:..     :.:.|...:||.                       
Human   410 ------------TPAWDEDTAQIGP-----KRIRKAAKRELM----------------------- 434

  Fly   548 KNYEKHCLRCKPYECQICGRVVRFRPNFIKHMRVHTGQQSERHKYKCEVCHKEFMSFEYFKVHKK 612
                       |.:...|||:                                |.:.:|...|||
Human   435 -----------PCDFPGCGRI--------------------------------FSNRQYLNHHKK 456

  Fly   613 ---IHNENVNLTCEICGKVFSALASLRGHSKLHSGVKLHKCDVCGKGFGQRYNLKIHARTHTGDF 674
               ||.::.:.....|||.|:....|:.|.||||..:.:.|:.|.:.|....||.||.|.|||:.
Human   457 YQHIHQKSFSCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEFCARSFRTSSNLVIHRRIHTGEK 521

  Fly   675 PFECKICKKKLHTQSSLQTHMQVH------LR----------DQPGAAAAAATAAGAASSKASNS 723
            |.:|:||......::||..|.:.|      ||          ::|.:.||..:.:..|...|...
Human   522 PLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQE 586

  Fly   724 SNS-------SNSSNSSSSNSSSNGVSAAVSAAT 750
            |.|       |.|:.....:|..:..||:..|.|
Human   587 SPSGPLEPCPSISAPGPLGSSEGSRPSASPQAPT 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32767NP_001162674.1 C2H2 Zn finger 537..557 CDD:275368 0/19 (0%)
C2H2 Zn finger 562..582 CDD:275368 3/19 (16%)
C2H2 Zn finger 594..614 CDD:275368 5/22 (23%)
C2H2 Zn finger 622..642 CDD:275368 7/19 (37%)
zf-C2H2 648..670 CDD:278523 8/21 (38%)
C2H2 Zn finger 650..670 CDD:275368 8/19 (42%)
zf-H2C2_2 662..684 CDD:290200 12/21 (57%)
C2H2 Zn finger 678..698 CDD:275368 6/19 (32%)
ZNF692XP_011542525.1 zf-C2H2 465..489 CDD:278523 7/23 (30%)
C2H2 Zn finger 467..489 CDD:275368 7/21 (33%)
COG5048 490..>591 CDD:227381 29/100 (29%)
zf-C2H2 495..517 CDD:278523 8/21 (38%)
C2H2 Zn finger 497..517 CDD:275368 8/19 (42%)
zf-H2C2_2 509..534 CDD:290200 12/24 (50%)
C2H2 Zn finger 525..545 CDD:275368 6/19 (32%)
C2H2 Zn finger 556..577 CDD:275368 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.