DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32767 and CG7691

DIOPT Version :9

Sequence 1:NP_001162674.1 Gene:CG32767 / 31430 FlyBaseID:FBgn0052767 Length:1281 Species:Drosophila melanogaster
Sequence 2:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster


Alignment Length:50 Identity:19/50 - (38%)
Similarity:28/50 - (56%) Gaps:2/50 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   649 KCDVCGKGFGQRYNLKIHARTHTGDFPFECK--ICKKKLHTQSSLQTHMQ 696
            :|..|.|.|...:.|..|.|||||:.||.|.  .|:|....:|:|::|.:
  Fly   190 ECIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32767NP_001162674.1 C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 562..582 CDD:275368
C2H2 Zn finger 594..614 CDD:275368
C2H2 Zn finger 622..642 CDD:275368
zf-C2H2 648..670 CDD:278523 7/20 (35%)
C2H2 Zn finger 650..670 CDD:275368 7/19 (37%)
zf-H2C2_2 662..684 CDD:290200 11/23 (48%)
C2H2 Zn finger 678..698 CDD:275368 6/20 (30%)
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 19/49 (39%)
C2H2 Zn finger 191..211 CDD:275368 7/19 (37%)
zf-H2C2_2 203..229 CDD:290200 12/25 (48%)
C2H2 Zn finger 219..244 CDD:275368 6/20 (30%)
C2H2 Zn finger 250..266 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.