powered by:
Protein Alignment CG32767 and CG7691
DIOPT Version :9
Sequence 1: | NP_001162674.1 |
Gene: | CG32767 / 31430 |
FlyBaseID: | FBgn0052767 |
Length: | 1281 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_650728.1 |
Gene: | CG7691 / 42228 |
FlyBaseID: | FBgn0038626 |
Length: | 283 |
Species: | Drosophila melanogaster |
Alignment Length: | 50 |
Identity: | 19/50 - (38%) |
Similarity: | 28/50 - (56%) |
Gaps: | 2/50 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 649 KCDVCGKGFGQRYNLKIHARTHTGDFPFECK--ICKKKLHTQSSLQTHMQ 696
:|..|.|.|...:.|..|.|||||:.||.|. .|:|....:|:|::|.:
Fly 190 ECIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQR 239
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR24393 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.