DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32767 and CG31388

DIOPT Version :9

Sequence 1:NP_001162674.1 Gene:CG32767 / 31430 FlyBaseID:FBgn0052767 Length:1281 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:449 Identity:91/449 - (20%)
Similarity:171/449 - (38%) Gaps:88/449 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 TYVRM--PAAAVISRSPMTVLNVVQQALPATQLILQTQQQQTPAAAAAEQQ--LALALEQQR--- 414
            |..||  ||.|.....|.: .:|::|....|.|.|: :..:.|.....:.|  |.:|::.:|   
  Fly     7 TCSRMADPAVAKNLFDPSS-SSVLRQIETLTNLQLK-EDGKLPRFMCQDCQHDLQIAIDFRRVCI 69

  Fly   415 QQQEQQAQQQRQQQQQQEQQRQQQQQQQQQQQQQAQ--------------------QEQQRQQQQ 459
            :.||....|.||.::::|......:|.......:..                    |::...:..
  Fly    70 EAQELLELQLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFIFDPEPQDKNTDELA 134

  Fly   460 QLQQQQQQQQTHPVKHSASGSSSTNNNSTTNSTN-------SNNNTPAATA----TVTTSYQCVE 513
            .::.....:..:..:..||..||...::.:..:|       |..:.|.:.|    ..::|:.|.:
  Fly   135 SIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNEHFDMGLSPESEPESEAIDNRDTSSSHTCSK 199

  Fly   514 CVEKFDSKELFDIH----------------------RSGHANNMKCAICNMVL-------KS--- 546
            |..:|::.:...:|                      ||..|....|.:.|:.|       ||   
  Fly   200 CGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTRHCNMINLPLTHSCTKCKSQFH 264

  Fly   547 ----LKNYEKHCLR--CKPYECQICGRVVRFRPNFIKHMRVHTGQQSERHKYKCEVCHKEFMSFE 605
                |:.:::.|||  ...:.|.|||:.:....|...|:..|.|  :.||  ||:.|...|.:..
  Fly   265 NHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAG--TRRH--KCDQCSASFYTAA 325

  Fly   606 YFKVHKKIHNENVNLTCEI-CGKVFSALASLRGHSKLH--SGVKLHKCDVCGKGFGQRYNLKIHA 667
            ....|:|.|.......|.. |||.|...::...|.::|  :..::::|:.|.|.:......:.|.
  Fly   326 ELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCPKSYVTPSECRTHQ 390

  Fly   668 RTHTGDFPFECKICKKKLHTQSSLQTHMQVHLRDQPGAAAAAATAAGAASSKASNSSNS 726
            :.|.......|:||:....|....::|::.:...   ...|.|.||.:.:|:..|.|.:
  Fly   391 KYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHK---TLEARAKAAASPNSRGRNCSTN 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32767NP_001162674.1 C2H2 Zn finger 537..557 CDD:275368 9/35 (26%)
C2H2 Zn finger 562..582 CDD:275368 6/19 (32%)
C2H2 Zn finger 594..614 CDD:275368 5/19 (26%)
C2H2 Zn finger 622..642 CDD:275368 6/20 (30%)
zf-C2H2 648..670 CDD:278523 4/21 (19%)
C2H2 Zn finger 650..670 CDD:275368 4/19 (21%)
zf-H2C2_2 662..684 CDD:290200 5/21 (24%)
C2H2 Zn finger 678..698 CDD:275368 5/19 (26%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 19/70 (27%)
C2H2 Zn finger 228..254 CDD:275368 6/25 (24%)
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..363 CDD:275368 6/20 (30%)
C2H2 Zn finger 373..393 CDD:275368 4/19 (21%)
C2H2 Zn finger 401..419 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.