DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32767 and CG11247

DIOPT Version :9

Sequence 1:NP_001162674.1 Gene:CG32767 / 31430 FlyBaseID:FBgn0052767 Length:1281 Species:Drosophila melanogaster
Sequence 2:NP_001097659.1 Gene:CG11247 / 40414 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster


Alignment Length:402 Identity:84/402 - (20%)
Similarity:158/402 - (39%) Gaps:96/402 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 RRPVYISNAVGGLTAGATYVRMPAAAVISRSPMTVLNVVQQALPATQLILQTQQQQTPAAAAAEQ 404
            ||.|...:||..||.....:..|.||             :::.|...|.::.::     ::.|..
  Fly     5 RRSVSKEDAVSLLTDSGISLSSPPAA-------------RESSPGPTLAIKRRK-----SSLASL 51

  Fly   405 QLALALEQQRQQQEQQAQQQRQQQQQQEQQRQQQQQQQQQQQQQAQQEQQRQQQQQLQQQ---QQ 466
            :.|...|::....||.::.....|.|.::..::.:..:::....:|..::...:..||:.   ..
  Fly    52 RDACVDEEEDDGGEQDSKDDDYVQPQLKKSARKGEPVKRKHHVCSQCSKEFGGKTDLQRHMLIHS 116

  Fly   467 QQQTHPVKHSASGSSSTNNNSTTNSTNSNNNTPAATATVTTSYQ------CVECVEKFDSKELFD 525
            .::.|..|..        ..|...:.|..|:       :||:::      |.:|.:.|..||...
  Fly   117 DERPHKCKDC--------GKSYRQAVNLKNH-------ITTAHEHRKQFVCSQCPKSFALKERLR 166

  Fly   526 IHRSGHANNMKCAICNMVLKSLKNYEKHCLRCKPYECQIC----GRVVRFRPNFIKH-------- 578
            :|...|:..                       |||.|.:|    .|..:.:.:.:.|        
  Fly   167 LHMRLHSGE-----------------------KPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQF 208

  Fly   579 --------------MRVHTGQQSERHKYKCEVCHKEFMSFEYFKVHKKIHNENVNLT---CEICG 626
                          :|||..:..:..:::|.:|..:|.:....:.|  |:.|:..||   ||||.
  Fly   209 NCTKCSASFSTNANLRVHMERHEQGMEHRCSICENQFANELALRAH--INQEHHKLTQFECEICH 271

  Fly   627 KVFSALASLRGHSKLHSGVKLHKCDVCGKGFGQRYNLKIHARTHTGDFPFECKICKKKLHTQSSL 691
            |:......|..|.:.|:.||.|.|:||...|.|:....:|.|.|||:.|::|:||.:.....|.|
  Fly   272 KMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVL 336

  Fly   692 QTHMQVHLRDQP 703
            :.|::.|..::|
  Fly   337 KLHIRKHTGEKP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32767NP_001162674.1 C2H2 Zn finger 537..557 CDD:275368 0/19 (0%)
C2H2 Zn finger 562..582 CDD:275368 5/45 (11%)
C2H2 Zn finger 594..614 CDD:275368 4/19 (21%)
C2H2 Zn finger 622..642 CDD:275368 7/19 (37%)
zf-C2H2 648..670 CDD:278523 8/21 (38%)
C2H2 Zn finger 650..670 CDD:275368 7/19 (37%)
zf-H2C2_2 662..684 CDD:290200 9/21 (43%)
C2H2 Zn finger 678..698 CDD:275368 6/19 (32%)
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 30/196 (15%)
C2H2 Zn finger 95..115 CDD:275368 3/19 (16%)
zf-H2C2_2 107..132 CDD:290200 5/32 (16%)
C2H2 Zn finger 123..144 CDD:275368 6/35 (17%)
C2H2 Zn finger 152..172 CDD:275368 6/19 (32%)
zf-H2C2_2 165..189 CDD:290200 7/46 (15%)
C2H2 Zn finger 180..200 CDD:275368 3/19 (16%)
COG5048 <192..369 CDD:227381 42/159 (26%)
C2H2 Zn finger 210..230 CDD:275370 3/19 (16%)
C2H2 Zn finger 238..260 CDD:275371 6/23 (26%)
C2H2 Zn finger 267..287 CDD:275368 7/19 (37%)
C2H2 Zn finger 295..315 CDD:275368 7/19 (37%)
zf-H2C2_2 309..332 CDD:290200 9/22 (41%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
C2H2 Zn finger 351..374 CDD:275368
C2H2 Zn finger 382..399 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.