DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32767 and CG17359

DIOPT Version :9

Sequence 1:NP_001162674.1 Gene:CG32767 / 31430 FlyBaseID:FBgn0052767 Length:1281 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:230 Identity:52/230 - (22%)
Similarity:91/230 - (39%) Gaps:62/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 HPVKHSASGSSSTNNNSTTNSTNSNNNTPAATATVTTSYQCVECVEKFDSKELFDIHRSGHANNM 535
            |.:..|.|.:.:.:|.|...:.:.::|         .|:.....:|..|..::::..:.|....:
  Fly   156 HKLAQSYSPAKTPHNKSKRRARSYSDN---------DSWSPDSELEHEDDDKIWNASKRGKPKRV 211

  Fly   536 KCAICNMVLKSLKNYEKHCLRCKPYECQICGRVVRFRPNFIKHMRVHTGQQSERHKYKCEVCHKE 600
            .                     .||.|::|.:....:.|...|||:|||::    .|||.:|.:.
  Fly   212 P---------------------GPYRCKLCTQSFTQKQNLEIHMRIHTGER----PYKCSLCPRS 251

  Fly   601 FMSFEYFKVHKKIHNENVNLTCEICGKVFSALASLRGHSKLHSGVKLHKCDVCGKGFGQRYNLKI 665
                                        |:...:|:.|::.|:|.:...|..|.|.|.|...|::
  Fly   252 ----------------------------FAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQV 288

  Fly   666 HARTHTGDFPFECKICKKKLHTQSSLQTHMQVHLR 700
            |.|||||:.||:|..|::.....:.||.||..|.|
  Fly   289 HTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTR 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32767NP_001162674.1 C2H2 Zn finger 537..557 CDD:275368 0/19 (0%)
C2H2 Zn finger 562..582 CDD:275368 6/19 (32%)
C2H2 Zn finger 594..614 CDD:275368 2/19 (11%)
C2H2 Zn finger 622..642 CDD:275368 3/19 (16%)
zf-C2H2 648..670 CDD:278523 8/21 (38%)
C2H2 Zn finger 650..670 CDD:275368 8/19 (42%)
zf-H2C2_2 662..684 CDD:290200 11/21 (52%)
C2H2 Zn finger 678..698 CDD:275368 6/19 (32%)
CG17359NP_648679.1 zf-AD 6..88 CDD:285071
zf-C2H2 215..237 CDD:278523 7/21 (33%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
zf-H2C2_2 229..254 CDD:290200 12/56 (21%)
C2H2 Zn finger 245..265 CDD:275368 5/47 (11%)
zf-H2C2_2 257..282 CDD:290200 8/24 (33%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 11/23 (48%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.