DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ovo and ZNF93

DIOPT Version :9

Sequence 1:	NP_001162673.1	Gene:	ovo / 31429	FlyBaseID:	FBgn0003028	Length:	1351	Species:	Drosophila melanogaster
Sequence 2:	NP_112495.2	Gene:	ZNF93 / 81931	HGNCID:	13169	Length:	620	Species:	Homo sapiens

Alignment Length:	162	Identity:	53/162 - (32%)
Similarity:	74/162 - (45%)	Gaps:	27/162 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly  1162 NSSASSNASSHGS---------AEALCMGSSGGANEDSSSGNNKFVCRVCMKTFSLQRLLNRHMK 1217
            :|:.||:..||..         .:|....|:...:|...:|...:.|..|.|.|:....|.:|.|
Human   409 SSTLSSHKRSHTGEKPYKCEECGKAFVASSTLSKHEIIHTGKKPYKCEECGKAFNQSSSLTKHKK 473

  Fly  1218 CHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQY 1282
            .|:..|.|.|..|||.||.:..|.:|.:.|||.:||||..|.|:|.|..:|..| :|:|:
Human   474 IHTGEKPYKCEECGKAFNQSSSLTKHKKIHTGEKPYKCEECGKAFNQSSTLIKH-KKIHT----- 532

  Fly  1283 AYKERRAKMYVCEECG-------HTTCEPEVH 1307
                 |.|.|.|||||       |.|....:|
Human   533 -----REKPYKCEECGKAFHLSTHLTTHKILH 559

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ovo	NP_001162673.1	C2H2 Zn finger	1199..1219	CDD:275368	7/19 (37%)
		zf-H2C2_2	1212..1235	CDD:290200	10/22 (45%)
		C2H2 Zn finger	1227..1247	CDD:275368	8/19 (42%)
		zf-H2C2_2	1239..1264	CDD:290200	12/24 (50%)
		C2H2 Zn finger	1255..1276	CDD:275368	8/20 (40%)
ZNF93	NP_112495.2	KRAB	4..62	CDD:214630
		KRAB	6..43	CDD:279668
		C2H2 Zn finger	147..167	CDD:275368
		COG5048	170..612	CDD:227381	53/162 (33%)
		C2H2 Zn finger	175..195	CDD:275368
		C2H2 Zn finger	203..223	CDD:275368
		zf-H2C2_2	215..238	CDD:290200
		C2H2 Zn finger	231..251	CDD:275368
		zf-H2C2_2	244..268	CDD:290200
		C2H2 Zn finger	259..279	CDD:275368
		zf-H2C2_2	272..296	CDD:290200
		C2H2 Zn finger	287..307	CDD:275368
		zf-H2C2_2	300..324	CDD:290200
		C2H2 Zn finger	315..335	CDD:275368
		zf-H2C2_2	328..350	CDD:290200
		C2H2 Zn finger	343..363	CDD:275368
		C2H2 Zn finger	371..391	CDD:275368
		zf-H2C2_2	384..408	CDD:290200
		C2H2 Zn finger	399..419	CDD:275368	3/9 (33%)
		zf-H2C2_2	412..435	CDD:290200	5/22 (23%)
		C2H2 Zn finger	427..447	CDD:275368	3/19 (16%)
		zf-H2C2_2	440..464	CDD:290200	6/23 (26%)
		C2H2 Zn finger	455..475	CDD:275368	7/19 (37%)
		zf-H2C2_2	467..492	CDD:290200	11/24 (46%)
		C2H2 Zn finger	483..503	CDD:275368	8/19 (42%)
		zf-H2C2_2	495..520	CDD:290200	12/24 (50%)
		C2H2 Zn finger	511..531	CDD:275368	8/20 (40%)
		zf-H2C2_2	524..547	CDD:290200	12/33 (36%)
		C2H2 Zn finger	539..559	CDD:275368	7/19 (37%)
		zf-H2C2_2	551..576	CDD:290200	3/9 (33%)
		C2H2 Zn finger	567..587	CDD:275368
		zf-H2C2_2	580..602	CDD:290200
		C2H2 Zn finger	595..615	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910