DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and ovol1a

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:XP_021333289.1 Gene:ovol1a / 792456 ZFINID:ZDB-GENE-031010-37 Length:319 Species:Danio rerio


Alignment Length:170 Identity:95/170 - (55%)
Similarity:115/170 - (67%) Gaps:13/170 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1163 SSASSNASSHGS---AEALCMGSSGGANEDSSSGNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKR 1224
            :|...:.::|.|   .:.|.:.|||..          :||:||.|.|..||:||||:||||:.||
Zfish   132 TSPPVSIATHCSPPVTKPLMVQSSGAT----------YVCQVCQKVFQFQRMLNRHLKCHSEQKR 186

  Fly  1225 YLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRA 1289
            :||.|||||||||||||||.|||||||||||.||:|:||||||||||.:|:|.|..||||||||:
Zfish   187 HLCDFCGKGFNDTFDLKRHVRTHTGVRPYKCELCDKAFTQRCSLESHMKKIHGVTQQYAYKERRS 251

  Fly  1290 KMYVCEECGHTTCEPEVHYLHLKNNHPFSPALLKFYDKRH 1329
            |:|||||||||....:....||...||.|..|.....:||
Zfish   252 KLYVCEECGHTASTQDALLRHLHTEHPNSAFLRAKGARRH 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 12/19 (63%)
zf-H2C2_2 1212..1235 CDD:290200 17/22 (77%)
C2H2 Zn finger 1227..1247 CDD:275368 17/19 (89%)
zf-H2C2_2 1239..1264 CDD:290200 20/24 (83%)
C2H2 Zn finger 1255..1276 CDD:275368 15/20 (75%)
ovol1aXP_021333289.1 C2H2 Zn finger 161..181 CDD:275368 12/19 (63%)
zf-H2C2_2 173..197 CDD:316026 17/23 (74%)
C2H2 Zn finger 189..209 CDD:275368 17/19 (89%)
zf-H2C2_2 201..226 CDD:316026 20/24 (83%)
C2H2 Zn finger 217..238 CDD:275368 15/20 (75%)
C2H2 Zn finger 256..275 CDD:275368 9/18 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3576
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001339
OrthoInspector 1 1.000 - - otm24752
orthoMCL 1 0.900 - - OOG6_105449
Panther 1 1.100 - - LDO PTHR10032
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3205
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.