DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and lratd1

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:NP_001072555.1 Gene:lratd1 / 780010 XenbaseID:XB-GENE-968953 Length:274 Species:Xenopus tropicalis


Alignment Length:195 Identity:38/195 - (19%)
Similarity:62/195 - (31%) Gaps:66/195 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1181 GSSGGAN-EDSSSGNNK----FVCRVCMKTFSLQRLLNRHMKCHSDIKRY----LCTFCGKGFND 1236
            |.||... .|.|.|..:    .:..:....||.|..:...::.:.|:..|    |.:||..|  |
 Frog    48 GQSGRFGVRDPSPGEEEEGHIVLNEIEFSAFSCQECIFSKIRGNQDLNVYPVQGLLSFCTPG--D 110

  Fly  1237 TFDL-------------KRHTRTHTG----VRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAY 1284
            ..:|             ..|...:.|    :..::..:.:.|..:   :...|.. ..|.:.|.|
 Frog   111 LVELLFVCPSKDHPPPPSPHWAVYVGQGQIIHLHRGEIRKDSLFE---VGGECMG-RVVSNWYRY 171

  Fly  1285 KERRAKMYVCEECGH----------TTCEP----------------EVH--------YLHLKNNH 1315
            :...|::.:...|||          |..|.                |||        .|||:.||
 Frog   172 RPLTAELVLQNACGHLGLRSEEICWTNSESFAAWCRFGNREFKAGGEVHTGDLQYFLKLHLEENH 236

  Fly  1316  1315
             Frog   237  236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 3/19 (16%)
zf-H2C2_2 1212..1235 CDD:290200 6/26 (23%)
C2H2 Zn finger 1227..1247 CDD:275368 6/32 (19%)
zf-H2C2_2 1239..1264 CDD:290200 4/41 (10%)
C2H2 Zn finger 1255..1276 CDD:275368 2/20 (10%)
lratd1NP_001072555.1 NLPC_P60 130..209 CDD:389795 13/82 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.