| Sequence 1: | NP_001162673.1 | Gene: | ovo / 31429 | FlyBaseID: | FBgn0003028 | Length: | 1351 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001008727.1 | Gene: | ZNF121 / 7675 | HGNCID: | 12904 | Length: | 390 | Species: | Homo sapiens |
| Alignment Length: | 341 | Identity: | 79/341 - (23%) |
|---|---|---|---|
| Similarity: | 131/341 - (38%) | Gaps: | 78/341 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1018 AHLQRPMSSSSSSGGTNSSNSSGGSSNSPLLDANAAAAAAAALLDTKPLIQSLGLPPDLQLEFVN 1082
Fly 1083 GGHGIK----NPLAVENAHGGHHRIRNIDCIDDLSKHGHHSQHQQQQ---GSPQQQNMQQSVQQQ 1140
Fly 1141 SVQQQQSLQQ--------QQQQQHHQHHSNS------------SASSNASSH-----GSAEALC- 1179
Fly 1180 ------MGSSG-GANEDSSSGNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDT 1237
Fly 1238 FDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKE---------------- 1286
Fly 1287 --RRAKMYVCEECGHT 1300 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ovo | NP_001162673.1 | C2H2 Zn finger | 1199..1219 | CDD:275368 | 7/19 (37%) |
| zf-H2C2_2 | 1212..1235 | CDD:290200 | 9/22 (41%) | ||
| C2H2 Zn finger | 1227..1247 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 1239..1264 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 1255..1276 | CDD:275368 | 9/20 (45%) | ||
| ZNF121 | NP_001008727.1 | C2H2 Zn finger | 65..82 | CDD:275368 | 3/18 (17%) |
| COG5048 | <85..270 | CDD:227381 | 35/194 (18%) | ||
| C2H2 Zn finger | 91..110 | CDD:275368 | 4/28 (14%) | ||
| C2H2 Zn finger | 119..138 | CDD:275368 | 3/18 (17%) | ||
| zf-C2H2 | 144..166 | CDD:278523 | 1/21 (5%) | ||
| C2H2 Zn finger | 146..166 | CDD:275368 | 1/19 (5%) | ||
| zf-H2C2_2 | 158..182 | CDD:290200 | 2/23 (9%) | ||
| C2H2 Zn finger | 174..194 | CDD:275368 | 3/19 (16%) | ||
| zf-H2C2_2 | 186..210 | CDD:290200 | 3/23 (13%) | ||
| C2H2 Zn finger | 202..222 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 215..239 | CDD:290200 | 4/23 (17%) | ||
| COG5048 | <226..388 | CDD:227381 | 43/124 (35%) | ||
| C2H2 Zn finger | 230..250 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 243..267 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 258..278 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 271..294 | CDD:290200 | 13/22 (59%) | ||
| C2H2 Zn finger | 286..306 | CDD:275368 | 9/20 (45%) | ||
| zf-H2C2_2 | 301..323 | CDD:290200 | 5/22 (23%) | ||
| C2H2 Zn finger | 314..334 | CDD:275368 | 1/19 (5%) | ||
| zf-H2C2_2 | 327..349 | CDD:290200 | 7/22 (32%) | ||
| C2H2 Zn finger | 342..362 | CDD:275368 | 5/7 (71%) | ||
| zf-H2C2_2 | 354..379 | CDD:290200 | |||
| C2H2 Zn finger | 370..390 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||