DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and OVOL3

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:XP_016882679.1 Gene:OVOL3 / 728361 HGNCID:14186 Length:213 Species:Homo sapiens


Alignment Length:153 Identity:75/153 - (49%)
Similarity:98/153 - (64%) Gaps:8/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1166 SSNASSHGSAEALCMGS--------SGGANEDSSSGNNKFVCRVCMKTFSLQRLLNRHMKCHSDI 1222
            ||:.||.|...|....|        :.|....:..|.....|.:|.|.|.|||:|.||:||||.:
Human    54 SSDCSSLGGPPAQQSSSVRDPWTAPTQGNLTSAPRGPGTLGCPLCPKAFPLQRMLTRHLKCHSPV 118

  Fly  1223 KRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKER 1287
            :|:||..|||||:|.||||||.|||||:||::|:.|.|:||||||||:|..|||.....|||:||
Human   119 RRHLCRCCGKGFHDAFDLKRHMRTHTGIRPFRCSACGKAFTQRCSLEAHLAKVHGQPASYAYRER 183

  Fly  1288 RAKMYVCEECGHTTCEPEVHYLH 1310
            |.|::|||:||.|:..|:.:..|
Human   184 REKLHVCEDCGFTSSRPDTYAQH 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 11/19 (58%)
zf-H2C2_2 1212..1235 CDD:290200 14/22 (64%)
C2H2 Zn finger 1227..1247 CDD:275368 14/19 (74%)
zf-H2C2_2 1239..1264 CDD:290200 16/24 (67%)
C2H2 Zn finger 1255..1276 CDD:275368 13/20 (65%)
OVOL3XP_016882679.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3576
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001339
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10032
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.