| Sequence 1: | NP_001162673.1 | Gene: | ovo / 31429 | FlyBaseID: | FBgn0003028 | Length: | 1351 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_067043.2 | Gene: | OVOL2 / 58495 | HGNCID: | 15804 | Length: | 275 | Species: | Homo sapiens |
| Alignment Length: | 217 | Identity: | 104/217 - (47%) |
|---|---|---|---|
| Similarity: | 128/217 - (58%) | Gaps: | 44/217 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1161 SNSSASSNASSHGSAEALCMGSSGGANEDS---------------------SSGNNKFV------ 1198
Fly 1199 -----CRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLC 1258
Fly 1259 EKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFSPALLK 1323
Fly 1324 FYDKRHFKFTNSQFANNLLGQL 1345 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ovo | NP_001162673.1 | C2H2 Zn finger | 1199..1219 | CDD:275368 | 12/19 (63%) |
| zf-H2C2_2 | 1212..1235 | CDD:290200 | 17/22 (77%) | ||
| C2H2 Zn finger | 1227..1247 | CDD:275368 | 18/19 (95%) | ||
| zf-H2C2_2 | 1239..1264 | CDD:290200 | 19/24 (79%) | ||
| C2H2 Zn finger | 1255..1276 | CDD:275368 | 15/20 (75%) | ||
| OVOL2 | NP_067043.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 15..101 | 12/49 (24%) | |
| C2H2 Zn finger | 121..141 | CDD:275368 | 12/19 (63%) | ||
| C2H2 Zn finger | 149..169 | CDD:275368 | 18/19 (95%) | ||
| zf-H2C2_2 | 161..186 | CDD:316026 | 19/24 (79%) | ||
| C2H2 Zn finger | 177..198 | CDD:275368 | 15/20 (75%) | ||
| C2H2 Zn finger | 216..233 | CDD:275368 | 8/16 (50%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3576 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0001339 | |
| OrthoInspector | 1 | 1.000 | - | - | otm40732 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_105449 | |
| Panther | 1 | 1.100 | - | - | O | PTHR10032 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3205 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.840 | |||||