DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and zbtb48

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:XP_696166.2 Gene:zbtb48 / 567773 ZFINID:ZDB-GENE-030131-4450 Length:760 Species:Danio rerio


Alignment Length:415 Identity:89/415 - (21%)
Similarity:138/415 - (33%) Gaps:103/415 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1022 RPMSSSSSSGGTNSSNSSGGSSNSPLLDANAAAAAAAALLDTKPLIQSLGLPPDLQLEFVNGGHG 1086
            :|:.|......|.:..:..|.......||...:.|:.   |..|.::|..:        ...|..
Zfish   130 KPLLSEPQPDQTPNKKTRSGQRTKNKADAFKLSTASD---DEPPALKSTTV--------TRSGRR 183

  Fly  1087 IKNP--LAVENAHGGHHRI----RNIDCIDD------LSKHGHHSQHQQQQGSPQQQNMQQSVQQ 1139
            :|.|  |..|:......|:    |....::|      .::.|.|.:|:....:.|...:..||..
Zfish   184 VKGPSRLVGESQISVVTRLGVGRRKASFVEDKEQETGATEDGDHPRHEDASETTQTTEVDISVDD 248

  Fly  1140 QS-----VQQQQS-------------LQQQQQQQHHQHHSNSSASSNASSHGSAEALCMGSSGGA 1186
            |:     |:...:             :.:...:::..|  :|..||..:..|..:........|.
Zfish   249 QNDDDDDVEDAANNDDDSDRGGSVDIIIEGTDEEYVPH--DSPCSSTKTPRGKRKEKSSNKKNGE 311

  Fly  1187 NEDSSSGNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGF----------------- 1234
            .....|......|..|.|||..:..|..|.:.|:..|.:.|..|||.:                 
Zfish   312 GTSKDSKKGAVQCPTCHKTFLSKYYLKVHNRRHTGEKPFKCGKCGKCYFRKENLLEHEARNCLTR 376

  Fly  1235 ----------NDTF----DLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQY--- 1282
                      :.||    :|:.||..||||.|.||..|.:.|.|:..|:.|..|||.....:   
Zfish   377 TELVFSCSKCSMTFKKRQELRHHTVMHTGVMPNKCTSCPEQFMQKRDLKIHMIKVHGAPKPHACP 441

  Fly  1283 ----------------AYKERRAKMYVCEECGHTTCEPEVHYLHLK----NNHPFSPALLK--FY 1325
                            |.|.|..|::|||||||.........:|:|    |..||...|..  |.
Zfish   442 LCPKCFLSRTELRLHEASKHRGEKLFVCEECGHRASSRNGLQMHIKAIHRNERPFVCQLCNHAFT 506

  Fly  1326 DKRHFKFTNSQFANNLLGQLPMPVH 1350
            .|.:.    |.......|:.|...|
Zfish   507 QKANL----SMHLRTHTGEKPFQCH 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 7/19 (37%)
zf-H2C2_2 1212..1235 CDD:290200 8/49 (16%)
C2H2 Zn finger 1227..1247 CDD:275368 9/50 (18%)
zf-H2C2_2 1239..1264 CDD:290200 12/24 (50%)
C2H2 Zn finger 1255..1276 CDD:275368 7/20 (35%)
zbtb48XP_696166.2 BTB 18..109 CDD:279045
BTB 35..116 CDD:197585
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
zf-H2C2_2 336..359 CDD:290200 8/22 (36%)
C2H2 Zn finger 352..403 CDD:275368 9/50 (18%)
C2H2 Zn finger 383..402 CDD:275368 5/18 (28%)
C2H2 Zn finger 411..432 CDD:275368 7/20 (35%)
C2H2 Zn finger 440..461 CDD:275368 1/20 (5%)
C2H2 Zn finger 469..490 CDD:275368 8/20 (40%)
COG5048 <495..643 CDD:227381 9/37 (24%)
C2H2 Zn finger 498..518 CDD:275368 4/23 (17%)
zf-H2C2_2 510..535 CDD:290200 4/22 (18%)
C2H2 Zn finger 526..546 CDD:275368 1/2 (50%)
zf-H2C2_2 538..562 CDD:290200
C2H2 Zn finger 554..571 CDD:275368
C2H2 Zn finger 586..603 CDD:275368
zf-H2C2_2 596..620 CDD:290200
C2H2 Zn finger 611..631 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.