DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and OVOL1

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:NP_004552.2 Gene:OVOL1 / 5017 HGNCID:8525 Length:267 Species:Homo sapiens


Alignment Length:135 Identity:98/135 - (72%)
Similarity:114/135 - (84%) Gaps:1/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1189 DSSSGNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPY 1253
            ||.|| :.|.||||.|.|:.||:||||||||:|:||:|||:||||||||||||||.|||||||||
Human   111 DSPSG-DLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPY 174

  Fly  1254 KCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFS 1318
            ||:||:|:||||||||||.:|:|.||.:|||||||||:|||||||.|:...|.|.||||.:||.|
Human   175 KCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDS 239

  Fly  1319 PALLK 1323
            |.|.|
Human   240 PLLRK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 14/19 (74%)
zf-H2C2_2 1212..1235 CDD:290200 18/22 (82%)
C2H2 Zn finger 1227..1247 CDD:275368 17/19 (89%)
zf-H2C2_2 1239..1264 CDD:290200 20/24 (83%)
C2H2 Zn finger 1255..1276 CDD:275368 15/20 (75%)
OVOL1NP_004552.2 C2H2 Zn finger 120..140 CDD:275368 14/19 (74%)
C2H2 Zn finger 148..168 CDD:275368 17/19 (89%)
zf-H2C2_2 160..185 CDD:316026 20/24 (83%)
C2H2 Zn finger 176..197 CDD:275368 15/20 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146909
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3576
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2044
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001339
OrthoInspector 1 1.000 - - otm40732
orthoMCL 1 0.900 - - OOG6_105449
Panther 1 1.100 - - LDO PTHR10032
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3205
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.