DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and ovol2

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:NP_001004998.1 Gene:ovol2 / 448478 XenbaseID:XB-GENE-854193 Length:287 Species:Xenopus tropicalis


Alignment Length:238 Identity:102/238 - (42%)
Similarity:132/238 - (55%) Gaps:36/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1106 IDCI------DDLSKHG-------HHSQHQQQQGS-------PQQQNMQQSVQQQSVQQQQSLQQ 1150
            ||||      |.||...       ...:.....||       |.....|..:...|.:.....:.
 Frog    36 IDCIFKYVTEDSLSNSSAGDPAGDSPERSSSDSGSCNGSITTPPHNTPQSGLVSPSRKDSTKQED 100

  Fly  1151 QQQQQHHQHHSNSSASSNASSHGSAEALCMGSSGGANEDSSSGNNKFVCRVCMKTFSLQRLLNRH 1215
            :::|....|....||.|....          ::|..:|:..|      |.:|.|.|.|||:||||
 Frog   101 EEEQTSDPHGKRPSARSKIKF----------TTGSCSEEIYS------CEICAKGFRLQRMLNRH 149

  Fly  1216 MKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQH 1280
            :|||:.:||:||||||||||||||||||.|||||:|||||.:|.|:||||||||||.:|:|.||.
 Frog   150 LKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEICNKAFTQRCSLESHLKKIHGVQQ 214

  Fly  1281 QYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFSPALLK 1323
            .||||:||.|::|||:||:|....|..|||:.::||.|..|.|
 Frog   215 GYAYKQRRDKLFVCEDCGYTGPSQEDLYLHVYDSHPGSAFLKK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 12/19 (63%)
zf-H2C2_2 1212..1235 CDD:290200 17/22 (77%)
C2H2 Zn finger 1227..1247 CDD:275368 18/19 (95%)
zf-H2C2_2 1239..1264 CDD:290200 18/24 (75%)
C2H2 Zn finger 1255..1276 CDD:275368 14/20 (70%)
ovol2NP_001004998.1 C2H2 Zn finger 133..153 CDD:275368 12/19 (63%)
zf-H2C2_2 145..169 CDD:372612 17/23 (74%)
C2H2 Zn finger 161..181 CDD:275368 18/19 (95%)
zf-H2C2_2 173..198 CDD:372612 18/24 (75%)
zf-C2H2_3rep 189..>250 CDD:376287 34/60 (57%)
C2H2 Zn finger 189..210 CDD:275368 14/20 (70%)
C2H2 Zn finger 228..245 CDD:275368 8/16 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001339
OrthoInspector 1 1.000 - - otm47916
Panther 1 1.100 - - O PTHR10032
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3205
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.