DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and hic1

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:NP_001002314.1 Gene:hic1 / 436585 ZFINID:ZDB-GENE-040713-2 Length:737 Species:Danio rerio


Alignment Length:470 Identity:96/470 - (20%)
Similarity:144/470 - (30%) Gaps:170/470 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   995 SLPSPTAAAAAAAAA----------AAAAAAAAAHL-----QRPMSS------SSSSGGTNSSNS 1038
            |:|.|..|....|.|          ..|:.:..:.|     :|..||      |..|..:.|..|
Zfish   179 SIPLPPHAGEIYAPAPIKGPPPYPPTKASLSPQSSLCLPPNERNCSSVYGLDLSKKSPNSQSQLS 243

  Fly  1039 SGGSSNSPLLDANAAAAAAAALLD--TKPLIQSLGLPPDLQLEFVNGGHG---IKNPLAVENAHG 1098
            ||   |..|:.:..........||  |.|::.    |.|...:...|.|.   ..:|..:.|   
Zfish   244 SG---NPHLISSLHPDEEPEGELDQSTSPMLS----PNDGSRKMDTGHHMGSLTPHPFPLPN--- 298

  Fly  1099 GHHRIRNIDCIDDLSKHGHHSQHQQQQGSP-------------------------QQQNMQQSVQ 1138
             |....|:       .|.|.||.|:|...|                         :..|.:...:
Zfish   299 -HPLAPNL-------PHLHRSQGQEQYPCPPSPEPIEDTRDQRRDASNIYRWVKNEPSNPEDEDE 355

  Fly  1139 QQSVQQQQSLQQQQQQQHHQ---HHSNSSASSNASSHGSAEALC-------------MGSSGG-- 1185
            .........:.:|.:::|||   ||.::....|.:..|.....|             .|||.|  
Zfish   356 DDEEDDSGGMGEQDKERHHQHMNHHKSNEEKLNTNERGYDRGTCDDGEDENGTGSEETGSSEGRP 420

  Fly  1186 -----------ANEDSSSGNNKFVCRVCMKTFSLQRLLNRHMKCHSD------------------ 1221
                       ..|..|.|:|.:||..|.|.|.....||.|::.|::                  
Zfish   421 SPPVPGGRYHMPYEPESFGDNLYVCIPCDKGFPSSEQLNAHVETHTEEELNNGSEMDSSNNSNSK 485

  Fly  1222 -------------------------------------IKRYLCTFCGKGFNDTFDLKRHTRTHTG 1249
                                                 |:.|.|:.|.|.:.|...|::|.:||..
Zfish   486 PTTVRAPTSLNSSSGLHSPYHDGKLAQNLHSIGLGEIIRPYRCSSCDKSYKDPATLRQHEKTHWL 550

  Fly  1250 VRPYKCNLCEKSFTQRCSLESHCQKVHSVQ------------HQYAYKERR-----AKMYVCEEC 1297
            .|||.|::|.|.||||.::..|.:....::            .||...|..     .|.|.|:.|
Zfish   551 TRPYPCSICGKKFTQRGTMTRHMRSHLGLKPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQVC 615

  Fly  1298 GHTTCEPEVHYLHLK 1312
            |....:......|:|
Zfish   616 GGKFAQQRNLISHMK 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 7/19 (37%)
zf-H2C2_2 1212..1235 CDD:290200 9/77 (12%)
C2H2 Zn finger 1227..1247 CDD:275368 6/19 (32%)
zf-H2C2_2 1239..1264 CDD:290200 11/24 (46%)
C2H2 Zn finger 1255..1276 CDD:275368 8/20 (40%)
hic1NP_001002314.1 BTB 18..119 CDD:279045
BTB 29..119 CDD:197585
C2H2 Zn finger 445..465 CDD:275368 7/19 (37%)
C2H2 Zn finger 528..548 CDD:275368 6/19 (32%)
zf-H2C2_2 541..565 CDD:290200 11/23 (48%)
zf-C2H2 554..576 CDD:278523 9/21 (43%)
C2H2 Zn finger 556..576 CDD:275368 8/19 (42%)
zf-H2C2_2 569..593 CDD:290200 1/23 (4%)
C2H2 Zn finger 584..604 CDD:275368 3/19 (16%)
zf-H2C2_2 597..621 CDD:290200 6/23 (26%)
C2H2 Zn finger 612..632 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4977
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.