DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and Zfp266

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:NP_001128490.1 Gene:Zfp266 / 367034 RGDID:1308643 Length:604 Species:Rattus norvegicus


Alignment Length:221 Identity:58/221 - (26%)
Similarity:86/221 - (38%) Gaps:69/221 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1163 SSASSNASSHGSAEALCMGSSGGANEDSSSGNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLC 1227
            |..|::..:|              ||:     ..|||:.|.|.|.....||.|::.|:.||.|.|
  Rat   356 SRLSAHVKTH--------------NEE-----KPFVCKECGKAFKNMSYLNDHVRIHTGIKSYKC 401

  Fly  1228 TFCGKGF------------------------NDTF----DLKRHTRTHTGVRPYKCNLCEKSFTQ 1264
            ..|||.|                        ..||    .|..|.|||||::||:|..|.|:|||
  Rat   402 MECGKAFLRWSGLTEHIRVHTGEKPYECKECGKTFSRSTQLTEHIRTHTGIKPYECKECGKAFTQ 466

  Fly  1265 RCSLESHCQKVHSVQHQYAYKERRAKMYVCEECG--HTTCEPEVHYLHLKNNH-PF------SPA 1320
            ...|.:|. ::||.:          |.:.|:|||  .|.....:|::...... ||      ...
  Rat   467 YSGLATHV-RIHSGE----------KPFACKECGKAFTRTSGLIHHVRTHTGEKPFECVHCGKTF 520

  Fly  1321 LLKFYDKRHFKFTNSQ--FANNLLGQ 1344
            :...:..:|.|..:.:  |..|:.|:
  Rat   521 ITSSHRTKHLKIHSGEKPFVCNICGK 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 7/19 (37%)
zf-H2C2_2 1212..1235 CDD:290200 12/46 (26%)
C2H2 Zn finger 1227..1247 CDD:275368 10/47 (21%)
zf-H2C2_2 1239..1264 CDD:290200 13/24 (54%)
C2H2 Zn finger 1255..1276 CDD:275368 8/20 (40%)
Zfp266NP_001128490.1 KRAB 41..97 CDD:214630
C2H2 Zn finger 265..281 CDD:275368
C2H2 Zn finger 289..309 CDD:275368
C2H2 Zn finger 317..337 CDD:275368
C2H2 Zn finger 345..365 CDD:275368 2/8 (25%)
zf-C2H2 371..393 CDD:395048 9/21 (43%)
C2H2 Zn finger 373..393 CDD:275368 7/19 (37%)
COG5048 <397..588 CDD:227381 42/161 (26%)
C2H2 Zn finger 401..421 CDD:275368 5/19 (26%)
C2H2 Zn finger 429..449 CDD:275368 5/19 (26%)
C2H2 Zn finger 457..477 CDD:275368 8/20 (40%)
C2H2 Zn finger 485..505 CDD:275368 6/19 (32%)
C2H2 Zn finger 513..533 CDD:275368 2/19 (11%)
C2H2 Zn finger 541..561 CDD:275368 2/6 (33%)
C2H2 Zn finger 569..589 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.