DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and CG12391

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster


Alignment Length:112 Identity:34/112 - (30%)
Similarity:50/112 - (44%) Gaps:11/112 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1190 SSSGNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRP-Y 1253
            |::....|.|..|..|||.::....|.|.|..|: :.|..|||.|...:..|.|.:.|...|. :
  Fly   409 STASVGPFECPNCDLTFSRKQSYVLHRKTHERIE-HACPICGKKFKVEWAYKTHMQRHEQERAHF 472

  Fly  1254 KCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHT 1300
            :|.||.|.|..|..|:.|..:.|. :|.:.|:        |:.|..|
  Fly   473 RCELCPKIFRLRAELKHHMAQRHD-EHGFIYE--------CKRCQRT 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 7/19 (37%)
zf-H2C2_2 1212..1235 CDD:290200 8/22 (36%)
C2H2 Zn finger 1227..1247 CDD:275368 7/19 (37%)
zf-H2C2_2 1239..1264 CDD:290200 9/25 (36%)
C2H2 Zn finger 1255..1276 CDD:275368 8/20 (40%)
CG12391NP_610639.1 zf-AD 240..313 CDD:285071
zf-C2H2 416..438 CDD:278523 8/21 (38%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-C2H2 443..465 CDD:278523 7/21 (33%)
C2H2 Zn finger 445..465 CDD:275368 7/19 (37%)
C2H2 Zn finger 474..491 CDD:275368 7/16 (44%)
C2H2 Zn finger 504..521 CDD:275368 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464959
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.