DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and hic2

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:NP_878289.2 Gene:hic2 / 359828 ZFINID:ZDB-GENE-030619-1 Length:560 Species:Danio rerio


Alignment Length:411 Identity:84/411 - (20%)
Similarity:132/411 - (32%) Gaps:154/411 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1024 MSSSSSSGGTNSSNSSGGSSNSPLLDANAAAAAAAALLDTKPLIQSL--GLPPDLQLEFVNGGHG 1086
            :|..|.||.|.:...|..|.......:.:.:.|.:|..|..|..|:|  |.|.:|       |.|
Zfish   212 LSKKSPSGSTATEEVSPSSIPQESPQSASESTANSASFDENPNTQNLTAGEPMEL-------GVG 269

  Fly  1087 IKNPLAVENAHGGHHRIRNIDCID-----DLSKHGHHSQHQQQQGSPQQQ--------------- 1131
                                :|.:     |:.:|....|..:|:..|:.:               
Zfish   270 --------------------ECEESQPPPDVDQHKSSRQVTRQRRQPKSEGKKGEDMERVTLPNG 314

  Fly  1132 ----------------NMQQSVQQQSVQQQQSLQQQQQQQHHQHHSNSSASSNASSH-----GSA 1175
                            |....|..|...:::.|:..|:|......|.:....|::::     |..
Zfish   315 VSKRLKVAGERLPAGGNGNSEVSFQCKDEEEGLENGQEQSEESGQSENEGGRNSANYVYRQEGFE 379

  Fly  1176 EALCMGSSGGANEDSSSGNNKFVCRVCMKTFSLQRLLNRHMKCH--------------------- 1219
            .||              |:|.:||..|.|.|.....||.|::.|                     
Zfish   380 PAL--------------GDNLYVCIPCGKGFPSSEELNAHVETHTEEELYIKEEDNDSYPKEDEV 430

  Fly  1220 --------------SDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLES 1270
                          ::.:|:.|:.|.|.:.|...|::|.:||...||:.||:|.|.||||.::..
Zfish   431 EAEDLSSQITQVHGTETRRFSCSVCNKSYKDPATLRQHEKTHWLTRPFPCNICGKMFTQRGTMTR 495

  Fly  1271 HCQKVHSVQHQYAYKERRAKMYVCEECG-------HTTCEPEVHYLHLKNNHPFSPALL--KFYD 1326
            |.:           .....|.:.|||||       ..|....||    ....|:...|.  ||..
Zfish   496 HMR-----------SHLGLKPFACEECGMRFTRQYRLTEHMRVH----SGEKPYECQLCGGKFTQ 545

  Fly  1327 KRHFKFTNSQFANNLLGQLPM 1347
            :|           ||:..|.|
Zfish   546 QR-----------NLISHLRM 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 7/19 (37%)
zf-H2C2_2 1212..1235 CDD:290200 8/57 (14%)
C2H2 Zn finger 1227..1247 CDD:275368 6/19 (32%)
zf-H2C2_2 1239..1264 CDD:290200 11/24 (46%)
C2H2 Zn finger 1255..1276 CDD:275368 9/20 (45%)
hic2NP_878289.2 BTB 18..118 CDD:279045
BTB 25..120 CDD:197585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..163
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..367 31/181 (17%)
C2H2 Zn finger 389..409 CDD:275368 7/19 (37%)
zf-C2H2 450..472 CDD:278523 6/21 (29%)
C2H2 Zn finger 452..472 CDD:275368 6/19 (32%)
zf-C2H2 478..500 CDD:278523 9/32 (28%)
C2H2 Zn finger 480..500 CDD:275368 9/30 (30%)
zf-H2C2_2 493..517 CDD:290200 7/34 (21%)
C2H2 Zn finger 508..528 CDD:275368 6/19 (32%)
zf-H2C2_2 521..545 CDD:290200 7/27 (26%)
C2H2 Zn finger 536..556 CDD:275368 8/31 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4977
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.