DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and Ovol1

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:XP_008758360.2 Gene:Ovol1 / 309164 RGDID:1306956 Length:272 Species:Rattus norvegicus


Alignment Length:135 Identity:95/135 - (70%)
Similarity:114/135 - (84%) Gaps:1/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1189 DSSSGNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPY 1253
            ||.:| :.|.|.:|.|:|:.||:||||||||:|:||:|||:||||||||||||||.|||||||||
  Rat   116 DSPNG-DLFTCHICQKSFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPY 179

  Fly  1254 KCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFS 1318
            ||:||:|:||||||||||.:|:|.||.:|||||||||:|||||||.|:...|.|.||||.:||.|
  Rat   180 KCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDS 244

  Fly  1319 PALLK 1323
            |.|.|
  Rat   245 PLLRK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 12/19 (63%)
zf-H2C2_2 1212..1235 CDD:290200 18/22 (82%)
C2H2 Zn finger 1227..1247 CDD:275368 17/19 (89%)
zf-H2C2_2 1239..1264 CDD:290200 20/24 (83%)
C2H2 Zn finger 1255..1276 CDD:275368 15/20 (75%)
Ovol1XP_008758360.2 C2H2 Zn finger 125..145 CDD:275368 12/19 (63%)
C2H2 Zn finger 153..173 CDD:275368 17/19 (89%)
zf-H2C2_2 165..190 CDD:404364 20/24 (83%)
C2H2 Zn finger 181..202 CDD:275368 15/20 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340563
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3576
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001339
OrthoInspector 1 1.000 - - otm44871
orthoMCL 1 0.900 - - OOG6_105449
Panther 1 1.100 - - LDO PTHR10032
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.740

Return to query results.
Submit another query.