Sequence 1: | NP_001162673.1 | Gene: | ovo / 31429 | FlyBaseID: | FBgn0003028 | Length: | 1351 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571558.2 | Gene: | hic1l / 30771 | ZFINID: | ZDB-GENE-030620-1 | Length: | 454 | Species: | Danio rerio |
Alignment Length: | 343 | Identity: | 74/343 - (21%) |
---|---|---|---|
Similarity: | 125/343 - (36%) | Gaps: | 94/343 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 1025 SSSSSSGGTNSSNSSGGSSNSPLLDANAAAAAAAALLDTKPLIQ-------------SLGLPPDL 1076
Fly 1077 QLEFVNGGHGIKNPLAVENAHGGHHRI--RNIDCI---DDLSKHGHHSQHQQQQGSPQQQNM--- 1133
Fly 1134 -------------QQSVQQQSVQQQQSLQQQQQQQHHQH-------------------------- 1159
Fly 1160 -------HSNSSASSNASSH----------GSAEALCMG---SSGGANEDSSSGNNK-------- 1196
Fly 1197 --FVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCE 1259
Fly 1260 KSFTQRCSLESHCQKVHS 1277 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ovo | NP_001162673.1 | C2H2 Zn finger | 1199..1219 | CDD:275368 | 7/19 (37%) |
zf-H2C2_2 | 1212..1235 | CDD:290200 | 8/22 (36%) | ||
C2H2 Zn finger | 1227..1247 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 1239..1264 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 1255..1276 | CDD:275368 | 8/20 (40%) | ||
hic1l | NP_571558.2 | BTB | 18..119 | CDD:306997 | 2/5 (40%) |
C2H2 Zn finger | 304..324 | CDD:275368 | 3/19 (16%) | ||
zf-C2H2 | 372..394 | CDD:306579 | 8/21 (38%) | ||
C2H2 Zn finger | 374..394 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 387..411 | CDD:316026 | 9/23 (39%) | ||
C2H2 Zn finger | 402..422 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 414..439 | CDD:316026 | 10/24 (42%) | ||
C2H2 Zn finger | 430..450 | CDD:275368 | 8/20 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 101 | 1.000 | Inparanoid score | I4977 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |