DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and Ovol2

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:XP_038960525.1 Gene:Ovol2 / 296201 RGDID:1306130 Length:274 Species:Rattus norvegicus


Alignment Length:222 Identity:101/222 - (45%)
Similarity:128/222 - (57%) Gaps:46/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1161 SNSSASSNASSHGSAEAL---------------CMGSSG------------------GANEDSSS 1192
            |:|..|.:|...|.||:.               ..|:.|                  |...||..
  Rat    53 SSSGCSCSAGEPGGAESSSSPRAPEPETPELHDAEGTDGHLAAMQRPVARSKIKFTTGTCNDSVI 117

  Fly  1193 GNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNL 1257
            .|    |.:|.|:|.|||:||||:|||:.:||:||||||||||||||||||.|||||:|||||.:
  Rat   118 HN----CDLCGKSFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEV 178

  Fly  1258 CEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFSPALL 1322
            |.|:||||||||||.:|:|.||.|||||:||.|:||||:||:|....|..|||:.:.||.|..|.
  Rat   179 CYKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGSTFLK 243

  Fly  1323 KFYDKRHFKFTNSQFANNLLGQLPMPV 1349
            |         |:.:.|..:..:|..|:
  Rat   244 K---------TSKKLAALMQNKLTSPL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 12/19 (63%)
zf-H2C2_2 1212..1235 CDD:290200 17/22 (77%)
C2H2 Zn finger 1227..1247 CDD:275368 18/19 (95%)
zf-H2C2_2 1239..1264 CDD:290200 18/24 (75%)
C2H2 Zn finger 1255..1276 CDD:275368 14/20 (70%)
Ovol2XP_038960525.1 COG5048 118..>169 CDD:227381 37/54 (69%)
C2H2 Zn finger 120..140 CDD:275368 12/19 (63%)
C2H2 Zn finger 148..168 CDD:275368 18/19 (95%)
zf-H2C2_2 160..185 CDD:404364 18/24 (75%)
zf-C2H2_3rep 176..>237 CDD:408638 36/60 (60%)
C2H2 Zn finger 176..197 CDD:275368 14/20 (70%)
C2H2 Zn finger 215..232 CDD:275368 8/16 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3576
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001339
OrthoInspector 1 1.000 - - otm44871
orthoMCL 1 0.900 - - OOG6_105449
Panther 1 1.100 - - O PTHR10032
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.