Sequence 1: | NP_001162673.1 | Gene: | ovo / 31429 | FlyBaseID: | FBgn0003028 | Length: | 1351 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038960525.1 | Gene: | Ovol2 / 296201 | RGDID: | 1306130 | Length: | 274 | Species: | Rattus norvegicus |
Alignment Length: | 222 | Identity: | 101/222 - (45%) |
---|---|---|---|
Similarity: | 128/222 - (57%) | Gaps: | 46/222 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 1161 SNSSASSNASSHGSAEAL---------------CMGSSG------------------GANEDSSS 1192
Fly 1193 GNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNL 1257
Fly 1258 CEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFSPALL 1322
Fly 1323 KFYDKRHFKFTNSQFANNLLGQLPMPV 1349 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ovo | NP_001162673.1 | C2H2 Zn finger | 1199..1219 | CDD:275368 | 12/19 (63%) |
zf-H2C2_2 | 1212..1235 | CDD:290200 | 17/22 (77%) | ||
C2H2 Zn finger | 1227..1247 | CDD:275368 | 18/19 (95%) | ||
zf-H2C2_2 | 1239..1264 | CDD:290200 | 18/24 (75%) | ||
C2H2 Zn finger | 1255..1276 | CDD:275368 | 14/20 (70%) | ||
Ovol2 | XP_038960525.1 | COG5048 | 118..>169 | CDD:227381 | 37/54 (69%) |
C2H2 Zn finger | 120..140 | CDD:275368 | 12/19 (63%) | ||
C2H2 Zn finger | 148..168 | CDD:275368 | 18/19 (95%) | ||
zf-H2C2_2 | 160..185 | CDD:404364 | 18/24 (75%) | ||
zf-C2H2_3rep | 176..>237 | CDD:408638 | 36/60 (60%) | ||
C2H2 Zn finger | 176..197 | CDD:275368 | 14/20 (70%) | ||
C2H2 Zn finger | 215..232 | CDD:275368 | 8/16 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3576 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001339 | |
OrthoInspector | 1 | 1.000 | - | - | otm44871 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_105449 | |
Panther | 1 | 1.100 | - | - | O | PTHR10032 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.810 |