DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and lin-48

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:NP_497759.1 Gene:lin-48 / 175485 WormBaseID:WBGene00003033 Length:280 Species:Caenorhabditis elegans


Alignment Length:304 Identity:132/304 - (43%)
Similarity:160/304 - (52%) Gaps:78/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1025 SSSSSSGGTNSSNSSGGSSNSPL----LDANAAAAAAAALLDTKPLIQSLGLPPDLQLEFVNGGH 1085
            ::|.|...||||.....:|...|    ||.:.:..|:......|..|.|..:.|  .:||||||:
 Worm    31 NTSISRSSTNSSKPEEKNSKKFLIERFLDDDPSPPASILSPSPKAAIPSPIINP--AVEFVNGGY 93

  Fly  1086 GIKNPLAVENAHGGHHRIRNIDCIDDLSKHGHHSQHQQQQGSPQQQNMQQSVQQQSVQQQQSLQQ 1150
            |:|||||                                       .:..|.:..|:.       
 Worm    94 GVKNPLA---------------------------------------PLISSFETTSIP------- 112

  Fly  1151 QQQQQHHQHHSNSSASSNASSHGSAEALCMGSSGGANEDSSSGNNKFVCRVCMKTFSLQRLLNRH 1215
                     .|..|.||           .:.||....:||      ..|.:|.|.|.||||||||
 Worm   113 ---------CSTVSPSS-----------LISSSKDEFQDS------LTCHICGKKFGLQRLLNRH 151

  Fly  1216 MKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQH 1280
            :|||||:|||||||||||||||||||||||||||||||||..||||||||||||||.:|||.|.|
 Worm   152 IKCHSDLKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCEQCEKSFTQRCSLESHLRKVHGVTH 216

  Fly  1281 QYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFSPALLKF 1324
            ||||||||:|::|||:||:|..:.||:..|:|..||||.|.|:|
 Worm   217 QYAYKERRSKVFVCEDCGYTDEKFEVYLSHIKVVHPFSAAYLRF 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 13/19 (68%)
zf-H2C2_2 1212..1235 CDD:290200 20/22 (91%)
C2H2 Zn finger 1227..1247 CDD:275368 19/19 (100%)
zf-H2C2_2 1239..1264 CDD:290200 22/24 (92%)
C2H2 Zn finger 1255..1276 CDD:275368 16/20 (80%)
lin-48NP_497759.1 C2H2 Zn finger 135..155 CDD:275368 13/19 (68%)
C2H2 Zn finger 163..183 CDD:275368 19/19 (100%)
zf-H2C2_2 175..200 CDD:290200 22/24 (92%)
C2H2 Zn finger 191..209 CDD:275368 15/17 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3576
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2044
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001339
OrthoInspector 1 1.000 - - oto18131
orthoMCL 1 0.900 - - OOG6_105449
Panther 1 1.100 - - LDO PTHR10032
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3205
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.