DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and LOC110437726

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:XP_021331500.1 Gene:LOC110437726 / 110437726 -ID:- Length:550 Species:Danio rerio


Alignment Length:197 Identity:55/197 - (27%)
Similarity:88/197 - (44%) Gaps:36/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1142 VQQQQSLQQQQQQQHHQHHSNSSASSNASSHGSAEALCMGSSGGANEDSSSGNNKFVCRVCMKTF 1206
            |:..:..|.:::.|:.:|.               |...:|.|....:.:.| :..|:|..|.|:|
Zfish    35 VESDELNQMKEKDQYEKHQ---------------EIRTVGKSEKKTQKTKS-HALFICCECGKSF 83

  Fly  1207 SLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESH 1271
            |.:..|..|.:.|:..|.|.|..|||.||...:.:.|.|.|||.:||||..|:..|||:.:|..|
Zfish    84 SHKPKLEVHRRIHTGEKPYECQHCGKSFNQKQNCEAHMRIHTGEKPYKCQQCDMQFTQKANLTVH 148

  Fly  1272 C-----QKVHSVQH---QYAYKER---------RAKMYVCEECGHTTCEPEVHYLHLK---NNHP 1316
            .     :|..:.||   .:..|:.         ..|.|.|::||.:..:|:...:|||   ...|
Zfish   149 MRVHTGEKTFNCQHCGKSFFQKQNLNVHMRVHTGEKPYQCQQCGKSFSQPQNLNVHLKVHTGEKP 213

  Fly  1317 FS 1318
            |:
Zfish   214 FT 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 7/19 (37%)
zf-H2C2_2 1212..1235 CDD:290200 9/22 (41%)
C2H2 Zn finger 1227..1247 CDD:275368 8/19 (42%)
zf-H2C2_2 1239..1264 CDD:290200 11/24 (46%)
C2H2 Zn finger 1255..1276 CDD:275368 8/25 (32%)
LOC110437726XP_021331500.1 COG5048 73..485 CDD:227381 47/143 (33%)
C2H2 Zn finger 76..96 CDD:275368 7/19 (37%)
C2H2 Zn finger 104..124 CDD:275368 8/19 (42%)
C2H2 Zn finger 132..152 CDD:275368 7/19 (37%)
C2H2 Zn finger 160..180 CDD:275368 3/19 (16%)
C2H2 Zn finger 188..208 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368 55/197 (28%)
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..292 CDD:275368
C2H2 Zn finger 300..320 CDD:275368
C2H2 Zn finger 328..348 CDD:275368
C2H2 Zn finger 356..376 CDD:275368
C2H2 Zn finger 384..404 CDD:275368
C2H2 Zn finger 412..432 CDD:275368
C2H2 Zn finger 440..460 CDD:275368
C2H2 Zn finger 468..488 CDD:275368
C2H2 Zn finger 496..514 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.