DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ovo and si:cabz01063885.1

DIOPT Version :9

Sequence 1:	NP_001162673.1	Gene:	ovo / 31429	FlyBaseID:	FBgn0003028	Length:	1351	Species:	Drosophila melanogaster
Sequence 2:	XP_009299352.1	Gene:	si:cabz01063885.1 / 103911018	ZFINID:	ZDB-GENE-161017-66	Length:	284	Species:	Danio rerio

Alignment Length:	144	Identity:	45/144 - (31%)
Similarity:	69/144 - (47%)	Gaps:	20/144 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly  1192 SGNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCN 1256
            :|.....|:||.|:|:....|..|::.|:..:.|.|:.|||.|..:.....|.|.|||.:|:||:
Zfish   133 TGEMSLTCKVCGKSFTSIYNLKSHLRTHTRERPYKCSHCGKAFMSSGARCAHIRIHTGEKPFKCS 197

  Fly  1257 LCEKSFTQRCSLESHCQKVHSVQHQYA------------YKERRAKM------YVCEECGHTTCE 1303
            ||.:|||||.:|.|| :.||:.:..::            |.:|..|:      :.|..||.....
Zfish   198 LCGRSFTQRSALASH-KTVHTGEKPFSCKACGKSFTAKRYLQRHVKLHTRVQPFTCGRCGKGFLN 261

  Fly  1304 PEVHYLHLKNNHPF 1317
             :..|.|.....||
Zfish   262 -KSSYQHHMEERPF 274

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ovo	NP_001162673.1	C2H2 Zn finger	1199..1219	CDD:275368	7/19 (37%)
		zf-H2C2_2	1212..1235	CDD:290200	8/22 (36%)
		C2H2 Zn finger	1227..1247	CDD:275368	7/19 (37%)
		zf-H2C2_2	1239..1264	CDD:290200	12/24 (50%)
		C2H2 Zn finger	1255..1276	CDD:275368	11/20 (55%)
si:cabz01063885.1	XP_009299352.1	C2H2 Zn finger	84..104	CDD:275368
		COG5048	<109..268	CDD:227381	42/136 (31%)
		C2H2 Zn finger	112..132	CDD:275368
		zf-C2H2	139..160	CDD:278523	7/20 (35%)
		C2H2 Zn finger	140..160	CDD:275368	7/19 (37%)
		zf-H2C2_2	152..175	CDD:290200	8/22 (36%)
		C2H2 Zn finger	168..188	CDD:275368	7/19 (37%)
		zf-H2C2_2	184..205	CDD:290200	12/20 (60%)
		C2H2 Zn finger	196..216	CDD:275368	11/20 (55%)
		zf-H2C2_2	208..232	CDD:290200	5/24 (21%)
		C2H2 Zn finger	224..244	CDD:275368	3/19 (16%)
		C2H2 Zn finger	252..269	CDD:275368	5/17 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910