DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and ovol1b

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:XP_003200887.1 Gene:ovol1b / 100534921 ZFINID:ZDB-GENE-091204-357 Length:285 Species:Danio rerio


Alignment Length:194 Identity:91/194 - (46%)
Similarity:115/194 - (59%) Gaps:21/194 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1125 QGSPQQQNMQQSVQQQSVQQQQSLQQQQQQQHHQHHSNSSASSNASSHGSAEALCMGSSGGANE- 1188
            ||.|...:.:..::.|||...:|             .....:.|..||..|      |...|.: 
Zfish    82 QGQPGNHDPECCIRTQSVPYMRS-------------KIKVTTGNMPSHQPA------SPENARKI 127

  Fly  1189 -DSSSGNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRP 1252
             |....::...|:||.|||:..|:|.||:||||:.|:|.|..||||||||||||||.||||||||
Zfish   128 VDIPPADSGLSCQVCQKTFTTARMLKRHLKCHSETKKYSCEHCGKGFNDTFDLKRHVRTHTGVRP 192

  Fly  1253 YKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHP 1316
            |||.:|.|:||||||||:|.:|:|:|..|||:||||.|:|||||||.|....|....||:..||
Zfish   193 YKCTMCAKAFTQRCSLEAHLKKIHAVTQQYAFKERRDKLYVCEECGLTAQTRESLQNHLQAQHP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 11/19 (58%)
zf-H2C2_2 1212..1235 CDD:290200 14/22 (64%)
C2H2 Zn finger 1227..1247 CDD:275368 16/19 (84%)
zf-H2C2_2 1239..1264 CDD:290200 19/24 (79%)
C2H2 Zn finger 1255..1276 CDD:275368 13/20 (65%)
ovol1bXP_003200887.1 C2H2 Zn finger 139..159 CDD:275368 11/19 (58%)
zf-H2C2_2 151..175 CDD:290200 14/23 (61%)
zf-C2H2 165..187 CDD:278523 17/21 (81%)
C2H2 Zn finger 167..187 CDD:275368 16/19 (84%)
zf-H2C2_2 179..204 CDD:290200 19/24 (79%)
C2H2 Zn finger 195..216 CDD:275368 13/20 (65%)
C2H2 Zn finger 234..251 CDD:275368 7/16 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3576
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001339
OrthoInspector 1 1.000 - - otm24752
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10032
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.