DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and LOC100334838

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:NP_001373222.1 Gene:LOC100334838 / 100334838 -ID:- Length:293 Species:Danio rerio


Alignment Length:234 Identity:61/234 - (26%)
Similarity:96/234 - (41%) Gaps:54/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1117 HHSQHQQQQGSPQQQNMQQSVQQQ---SVQQQQSL---QQQQQQQHHQHHSNSS--ASSNASSHG 1173
            |....:|......::..::|:.||   ||...:||   .|..:...|:|..|:.  ..:....|.
Zfish    32 HEDPEEQTDRIVPEEKSEESLDQQENLSVHTGESLYTCPQCGKTFIHRHSFNAHILIHTKDKPHN 96

  Fly  1174 SAEALCMGSSGGANEDSSSGNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTF 1238
            :                        |..|.|:|..::.||.||:.||.:|.::|:.|||.|:...
Zfish    97 T------------------------CAQCGKSFVHKKSLNVHMRTHSGVKPHVCSQCGKSFSYKH 137

  Fly  1239 DLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGH---T 1300
            .|..|.|.|||.:|:.|..|.:|||.:..|:.| .|.|:.:        :..:|.|::||.   |
Zfish   138 CLNAHVRIHTGEKPFSCRQCAESFTHQGQLQLH-MKTHTGE--------KPPVYTCQQCGKSFGT 193

  Fly  1301 TCEPEVHYLHLKNNHPFS----------PALLKFYDKRH 1329
            ....:||.|......||.          .:|||.:.|.|
Zfish   194 ITILKVHMLIHAGGKPFGCEQCGRRFSHKSLLKNHLKAH 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 8/19 (42%)
zf-H2C2_2 1212..1235 CDD:290200 11/22 (50%)
C2H2 Zn finger 1227..1247 CDD:275368 8/19 (42%)
zf-H2C2_2 1239..1264 CDD:290200 11/24 (46%)
C2H2 Zn finger 1255..1276 CDD:275368 8/20 (40%)
LOC100334838NP_001373222.1 COG5048 <57..231 CDD:227381 54/206 (26%)
C2H2 Zn finger 69..89 CDD:275368 4/19 (21%)
C2H2 Zn finger 98..118 CDD:275368 8/19 (42%)
C2H2 Zn finger 126..146 CDD:275368 8/19 (42%)
C2H2 Zn finger 154..174 CDD:275368 8/20 (40%)
C2H2 Zn finger 184..204 CDD:275368 7/19 (37%)
C2H2 Zn finger 212..232 CDD:275368 4/19 (21%)
COG5048 236..>289 CDD:227381
C2H2 Zn finger 240..260 CDD:275368
C2H2 Zn finger 268..288 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.