| Sequence 1: | NP_001162673.1 | Gene: | ovo / 31429 | FlyBaseID: | FBgn0003028 | Length: | 1351 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001108581.1 | Gene: | znf1147 / 100141494 | ZFINID: | ZDB-GENE-080218-13 | Length: | 260 | Species: | Danio rerio |
| Alignment Length: | 230 | Identity: | 63/230 - (27%) |
|---|---|---|---|
| Similarity: | 94/230 - (40%) | Gaps: | 71/230 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1136 SVQQQSVQQQQSLQQQQQQQHHQHH----------------SNSSASSNASSHGSAEALCMGSSG 1184
Fly 1185 GANEDSSSGNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTG 1249
Fly 1250 VRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECG---------------H 1299
Fly 1300 T-----TCEP-----------EVHYLHLKNNHPFS 1318 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ovo | NP_001162673.1 | C2H2 Zn finger | 1199..1219 | CDD:275368 | 8/19 (42%) |
| zf-H2C2_2 | 1212..1235 | CDD:290200 | 9/22 (41%) | ||
| C2H2 Zn finger | 1227..1247 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 1239..1264 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 1255..1276 | CDD:275368 | 8/20 (40%) | ||
| znf1147 | NP_001108581.1 | zf-C2H2 | 82..104 | CDD:278523 | 9/21 (43%) |
| C2H2 Zn finger | 84..104 | CDD:275368 | 8/19 (42%) | ||
| COG5048 | <86..257 | CDD:227381 | 48/149 (32%) | ||
| zf-H2C2_2 | 96..121 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 112..132 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 125..149 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 140..160 | CDD:275368 | 8/20 (40%) | ||
| zf-H2C2_2 | 152..177 | CDD:290200 | 10/35 (29%) | ||
| C2H2 Zn finger | 168..188 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 180..205 | CDD:290200 | 4/24 (17%) | ||
| C2H2 Zn finger | 196..216 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 208..230 | CDD:290200 | 6/16 (38%) | ||
| C2H2 Zn finger | 224..244 | CDD:275368 | 63/230 (27%) | ||
| zf-H2C2_2 | 236..259 | CDD:290200 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||