Sequence 1: | NP_001162673.1 | Gene: | ovo / 31429 | FlyBaseID: | FBgn0003028 | Length: | 1351 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001096093.1 | Gene: | zgc:171929 / 100124596 | ZFINID: | ZDB-GENE-070820-19 | Length: | 253 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 97/207 - (46%) |
---|---|---|---|
Similarity: | 136/207 - (65%) | Gaps: | 42/207 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 1160 HSNSSASSNASSHGSAEALC-----------------------------------MGSSGGA--- 1186
Fly 1187 -NEDSSSGNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGV 1250
Fly 1251 RPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNH 1315
Fly 1316 PFSPALLKFYDK 1327 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ovo | NP_001162673.1 | C2H2 Zn finger | 1199..1219 | CDD:275368 | 12/19 (63%) |
zf-H2C2_2 | 1212..1235 | CDD:290200 | 15/22 (68%) | ||
C2H2 Zn finger | 1227..1247 | CDD:275368 | 16/19 (84%) | ||
zf-H2C2_2 | 1239..1264 | CDD:290200 | 19/24 (79%) | ||
C2H2 Zn finger | 1255..1276 | CDD:275368 | 16/20 (80%) | ||
zgc:171929 | NP_001096093.1 | C2H2 Zn finger | 101..121 | CDD:275368 | 12/19 (63%) |
zf-C2H2 | 127..149 | CDD:278523 | 16/21 (76%) | ||
C2H2 Zn finger | 129..149 | CDD:275368 | 16/19 (84%) | ||
zf-H2C2_2 | 141..166 | CDD:290200 | 19/24 (79%) | ||
C2H2 Zn finger | 157..178 | CDD:275368 | 16/20 (80%) | ||
C2H2 Zn finger | 196..214 | CDD:275368 | 8/17 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001339 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |