DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and zgc:171929

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:NP_001096093.1 Gene:zgc:171929 / 100124596 ZFINID:ZDB-GENE-070820-19 Length:253 Species:Danio rerio


Alignment Length:207 Identity:97/207 - (46%)
Similarity:136/207 - (65%) Gaps:42/207 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1160 HSNSSASSNASSHGSAEALC-----------------------------------MGSSGGA--- 1186
            |::::|   |.:|.|.:::|                                   :.||..|   
Zfish    26 HTHTAA---AHTHTSLDSVCAPAVQKHTAAPAAAALERHRGDYVMERLPPPPPAALSSSAAALHK 87

  Fly  1187 -NEDSSSGNNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGV 1250
             .:.||:|:::|:|.||.|.|.|||:|.||:||||.|||:.|.:||||||||||||||.|||||:
Zfish    88 PRDASSAGSSEFLCSVCHKLFPLQRMLTRHLKCHSLIKRHPCRYCGKGFNDTFDLKRHMRTHTGI 152

  Fly  1251 RPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNH 1315
            |||:|:||||:||||||||||.:|:|.||.||||::||:|::|||:||.|:..|:.::||::..|
Zfish   153 RPYRCDLCEKAFTQRCSLESHLRKIHGVQQQYAYRQRRSKIFVCEDCGFTSSRPDQYFLHVRQQH 217

  Fly  1316 PFSPALLKFYDK 1327
            |.||||.::|.|
Zfish   218 PGSPALRRYYRK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 12/19 (63%)
zf-H2C2_2 1212..1235 CDD:290200 15/22 (68%)
C2H2 Zn finger 1227..1247 CDD:275368 16/19 (84%)
zf-H2C2_2 1239..1264 CDD:290200 19/24 (79%)
C2H2 Zn finger 1255..1276 CDD:275368 16/20 (80%)
zgc:171929NP_001096093.1 C2H2 Zn finger 101..121 CDD:275368 12/19 (63%)
zf-C2H2 127..149 CDD:278523 16/21 (76%)
C2H2 Zn finger 129..149 CDD:275368 16/19 (84%)
zf-H2C2_2 141..166 CDD:290200 19/24 (79%)
C2H2 Zn finger 157..178 CDD:275368 16/20 (80%)
C2H2 Zn finger 196..214 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001339
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.