DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp4E and PTPRR

DIOPT Version :10

Sequence 1:NP_525076.2 Gene:Ptp4E / 31425 FlyBaseID:FBgn0004368 Length:1767 Species:Drosophila melanogaster
Sequence 2:NP_002840.2 Gene:PTPRR / 5801 HGNCID:9680 Length:657 Species:Homo sapiens


Alignment Length:31 Identity:7/31 - (22%)
Similarity:18/31 - (58%) Gaps:1/31 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 KEAMEASIQL-EVDKIDEELKKVEGKEVNIQ 166
            ::.:..::|: |.....||:|.::|...|::
Human   274 EQRIRQNVQVFEFQLTSEEMKAIDGLNRNVR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp4ENP_525076.2 FN3 <94..>334 CDD:442628 7/31 (23%)
fn3 247..328 CDD:394996
FN3 319..>749 CDD:442628
fn3 708..796 CDD:394996
fn3 902..978 CDD:394996
fn3 1013..1092 CDD:394996
PTP_tm 1127..1247 CDD:465889
R3-PTPc 1358..1579 CDD:350396
PTPRRNP_002840.2 R-PTPc-R 417..642 CDD:350459
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.