DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp4E and Ptp36E

DIOPT Version :9

Sequence 1:NP_001162669.1 Gene:Ptp4E / 31425 FlyBaseID:FBgn0004368 Length:1767 Species:Drosophila melanogaster
Sequence 2:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster


Alignment Length:335 Identity:103/335 - (30%)
Similarity:163/335 - (48%) Gaps:35/335 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1305 PNRPVHVKDFSEHYRIMSADSDFR------FSEEFEELKHVGRDQACSFANLPCNRPKNRFTNIL 1363
            ||.|:.::.|.:.       .|.|      :..||:....| ....|..|....|..||:....:
  Fly    79 PNGPIDIRHFLKL-------CDLRRKFPVLYKLEFQTAAKV-ESNTCRHALKKNNLEKNQNPKCI 135

  Fly  1364 PYDHSRFKLQPVDDDDGSDYINANYMPGHNSPREFIVTQGPLHSTREEFWRMCWESNSRAIVMLT 1428
            |||::|..|:.|.....|||:||:|:.....|..:||||||:..|.:.:|||.|:.|..||||||
  Fly   136 PYDYNRVVLEKVGGLQDSDYVNASYVDSLLKPNAYIVTQGPVEETVQAYWRMVWQENISAIVMLT 200

  Fly  1429 RCFEKGREKCDQYWPVD-RVAMFYGDIKVQLIIDTHYHDWSISEFMVSRNCE------SRIMRHF 1486
            :.|:..:..|.||||.: .|...||||.:.::.:....::.|..|.:.:..|      .|::..|
  Fly   201 KTFDFAKVMCHQYWPPNMEVHEQYGDIFINIVREEQLANFHIRTFRLYKMNEKQEVTDERLILQF 265

  Fly  1487 HFTTWPDFGVPEPPQSLVRFVRAFRDVIGT------DMR-PIIVHCSAGVGRSGTFIALDRILQH 1544
            |:|.|.....|. ..:|:.|.|..|.|:|.      ||| ||:||||.|.||||.::::|..|:.
  Fly   266 HYTEWYSHSCPF-SNALLEFRRRVRLVVGNIIKDEDDMRGPILVHCSDGGGRSGVYMSIDANLEL 329

  Fly  1545 IHKSDYVDIFGIVFAMRKERVFMVQTEQQYVCIHQCLLAVLEGKEHLLADSLELHANDGYEVTKI 1609
            ..:.:..::||.:..:|:.|..:|:..:||..|:..|      :||::........::..:..|.
  Fly   330 AEEEECFNVFGYLKKLRQSRKGLVENVEQYKFIYDTL------EEHIICGKTWFPVSELSDRLKA 388

  Fly  1610 YLERQPQTKM 1619
            ...|...|||
  Fly   389 KARRNSGTKM 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp4ENP_001162669.1 FN3 151..242 CDD:238020
fn3 247..328 CDD:278470
fn3 343..417 CDD:278470
fn3 443..525 CDD:278470
FN3 548..611 CDD:238020
FN3 620..706 CDD:238020
fn3 708..796 CDD:278470
fn3 824..886 CDD:278470
fn3 902..978 CDD:278470
fn3 1013..1092 CDD:278470
UP_III_II 1106..>1248 CDD:297589
PTPc 1329..1582 CDD:214550 89/266 (33%)
PTPc 1355..1582 CDD:238006 83/240 (35%)
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 85/249 (34%)
Y_phosphatase 428..671 CDD:395053
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19134
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.