DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp4E and pyp3

DIOPT Version :9

Sequence 1:NP_001162669.1 Gene:Ptp4E / 31425 FlyBaseID:FBgn0004368 Length:1767 Species:Drosophila melanogaster
Sequence 2:NP_594934.1 Gene:pyp3 / 2541443 PomBaseID:SPAC11E3.09 Length:303 Species:Schizosaccharomyces pombe


Alignment Length:253 Identity:94/253 - (37%)
Similarity:147/253 - (58%) Gaps:20/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1356 KNRFTNILPYDHSRFKLQPVDDDDGSDYINANY--MPGHNSPREFIVTQGPLHSTREEFWRMCWE 1418
            :||::||:||:::|.:|.|: ..:..|||||:.  :|   |.:.||.||||..::.:.||:|.|:
pombe    52 RNRYSNIVPYENTRVRLDPM-WKEACDYINASIVKIP---SGKTFIATQGPTSNSIDVFWKMVWQ 112

  Fly  1419 S--NSRAIVMLTRCFEKGREKCDQYWPVDRV-AMFYGDIKVQLI---IDTHYHDWSISEFMVSRN 1477
            |  .|..|||||:..|:.|.|||.||||:.. .:..||:.|.|:   ..|..::..:.||.::::
pombe   113 SVPKSGIIVMLTKLRERHRLKCDIYWPVELFETLNIGDLSVILVKVYTLTSLNEVQVREFELNKD 177

  Fly  1478 CESRIMRHFHFTTWPDFGVPEPPQ--SLVRFVRAFRDVIGTDMRPIIVHCSAGVGRSGTFIALDR 1540
            ...:.:.||::..|||||.|....  ||.|::::.......:..|||||||||.||:|||:||..
pombe   178 GVKKKILHFYYNGWPDFGAPHTFSLLSLTRYIKSLSYSPDFETAPIIVHCSAGCGRTGTFMALFE 242

  Fly  1541 ILQH------IHKSDYVDIFGIVFAMRKERVFMVQTEQQYVCIHQCLLAVLEGKEHLL 1592
            ||..      ..|.:..:|..||.::|.:|:..||:..|.|.::.....:|:|||.||
pombe   243 ILSQTDDSTSTSKFEVDNIANIVSSLRSQRMQSVQSVDQLVFLYTVSQELLQGKEFLL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp4ENP_001162669.1 FN3 151..242 CDD:238020
fn3 247..328 CDD:278470
fn3 343..417 CDD:278470
fn3 443..525 CDD:278470
FN3 548..611 CDD:238020
FN3 620..706 CDD:238020
fn3 708..796 CDD:278470
fn3 824..886 CDD:278470
fn3 902..978 CDD:278470
fn3 1013..1092 CDD:278470
UP_III_II 1106..>1248 CDD:297589
PTPc 1329..1582 CDD:214550 88/241 (37%)
PTPc 1355..1582 CDD:238006 88/241 (37%)
pyp3NP_594934.1 COG5599 1..303 CDD:227886 94/253 (37%)
AbiGii_2 <18..69 CDD:293478 7/16 (44%)
PTPc 52..291 CDD:238006 88/242 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 156 1.000 Domainoid score I1041
eggNOG 1 0.900 - - E2759_KOG0791
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47137
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3031
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.