DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp4E and Ptprf

DIOPT Version :10

Sequence 1:NP_525076.2 Gene:Ptp4E / 31425 FlyBaseID:FBgn0004368 Length:1767 Species:Drosophila melanogaster
Sequence 2:XP_006502927.1 Gene:Ptprf / 19268 MGIID:102695 Length:1924 Species:Mus musculus


Alignment Length:243 Identity:50/243 - (20%)
Similarity:86/243 - (35%) Gaps:65/243 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KIYTVWMGTDPAVIIT-------GYKELKDTFVNDGHSYLDKMIYSKLNTSLRGGDYGVIDTNGN 117
            :|.|:.||..||...|       |...|.:.|||:.::   |.....||          ::.|.:
Mouse   339 EIATMIMGISPAYPFTQDIVHDVGITVLIENFVNNPNA---KKYPRNLN----------LNANPD 390

  Fly   118 TWKEHRKFALH---TLRDFGMGKEAMEASIQLEVDKIDEELKKVEGKEVNIQEHFDLAIGNIINQ 179
            ..:|.|:...|   ..||  :....:..|:|:      ||||.:....|....|.  .:...:..
Mouse   391 APEEVRETEAHVNKVCRD--ILSCPLNCSVQV------EELKLLVSLSVKFDYHH--VVIYYVRY 445

  Fly   180 FL-FGNRFKDSSKFNELKKLLDL-----------FFEVQGSLRVYF---------------AYTV 217
            |: ..|:.....||..|:.:|.|           ..||..||..:|               ...:
Mouse   446 FISLLNKGSVKIKFQILRVILCLSKNQANTRELISAEVMSSLVAHFHKNESKANILHIIEIFENI 510

  Fly   218 DFLPQWMVELLTPDVSRVRDGIYQF-----FDEQIEEHRQEIDFETSD 260
            :|..:...:|.|.::....:.|..|     ||:::::.....|.:..|
Mouse   511 NFQFKKRAKLFTKEMFTKSELISIFREAKEFDQKLQDLTDHSDPDVRD 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp4ENP_525076.2 FN3 <94..>334 CDD:442628 38/202 (19%)
fn3 247..328 CDD:394996 2/14 (14%)
FN3 319..>749 CDD:442628
fn3 708..796 CDD:394996
fn3 902..978 CDD:394996
fn3 1013..1092 CDD:394996
PTP_tm 1127..1247 CDD:465889
R3-PTPc 1358..1579 CDD:350396
PtprfXP_006502927.1 I-set 33..124 CDD:400151
Ig strand B 50..54 CDD:409353
Ig strand C 63..67 CDD:409353
Ig strand E 86..93 CDD:409353
Ig strand F 104..109 CDD:409353
Ig strand G 117..120 CDD:409353
IgI_2_RPTP_IIa_LAR_like 136..232 CDD:409400
Ig strand A 136..138 CDD:409400
Ig strand A' 143..147 CDD:409400
Ig strand B 150..159 CDD:409400
Ig strand C 164..170 CDD:409400
Ig strand C' 172..174 CDD:409400
Ig strand D 183..187 CDD:409400
Ig strand E 196..201 CDD:409400
Ig strand F 210..217 CDD:409400
Ig strand G 220..231 CDD:409400
IgI_3_RPTP_IIa_LAR_like 241..322 CDD:409401
Ig strand A 241..243 CDD:409401
Ig strand A' 247..251 CDD:409401
Ig strand B 254..262 CDD:409401
Ig strand C 267..273 CDD:409401
Ig strand C' 275..277 CDD:409401
Ig strand D 280..284 CDD:409401
Ig strand E 289..294 CDD:409401
FN3 294..718 CDD:442628 50/243 (21%)
Ig strand F 301..308 CDD:409401
Ig strand G 312..321 CDD:409401
FN3 598..1065 CDD:442628
PTP_DSP_cys 1352..1627 CDD:475123
R-PTP-F-2 1629..1919 CDD:350477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.