DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp4E and Y39A3A.4

DIOPT Version :9

Sequence 1:NP_001162669.1 Gene:Ptp4E / 31425 FlyBaseID:FBgn0004368 Length:1767 Species:Drosophila melanogaster
Sequence 2:NP_001370800.1 Gene:Y39A3A.4 / 189720 WormBaseID:WBGene00021435 Length:265 Species:Caenorhabditis elegans


Alignment Length:265 Identity:74/265 - (27%)
Similarity:114/265 - (43%) Gaps:61/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1292 QDELAALP--EGYITPNRPVHVKDFSEHYRIMSADSDFRFS-EEFEELKHVGRDQACSFANLPCN 1353
            :|.|..|.  |.:|.....:.:....:.||.:.|..|...: :.:.:..|               
 Worm    28 EDHLQYLKALENFIFSTEKLGIDGLVKQYRKLDAKQDPSLTYDAYTKYMH--------------- 77

  Fly  1354 RPKNRFTNILPYDHSRFKLQPVDDDDGSDYINANYMPGHNSPREFIVTQGPLHSTREEFWRMCWE 1418
              |||:.:::..|:||.||: :|.....|||:|||:..:.....||.:||||..|..:||||.::
 Worm    78 --KNRYCDVVCLDNSRVKLK-IDKSRHGDYIHANYVKTNYLRSTFICSQGPLQHTIIDFWRMIFQ 139

  Fly  1419 SNSRAIVMLTRCFEKGREKCDQYWPVDRVAMFYGDIKVQLIIDTHYHDWSISEFMVSR------- 1476
            ..:.:|::|.:.   |||...:|||...|...||.|:|     |::.: |..||.:..       
 Worm   140 ERAESILLLCKV---GREGRPRYWPSLGVTETYGCIRV-----TNFSE-SSEEFEICNLAVTFVP 195

  Fly  1477 ----------NCESRIMRHFHFTTWPDFGVPEP-----PQSLVRFVRAFRDVIGTDMRPIIVHCS 1526
                      |.|...:....:..|||.|||:.     ||.|:..||         ..|.:||||
 Worm   196 DNVPVDEQPANLEGLRVSLIKWPNWPDCGVPDEKCHTVPQRLLAQVR---------HGPCVVHCS 251

  Fly  1527 AGVGR 1531
            ||..|
 Worm   252 AGKDR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp4ENP_001162669.1 FN3 151..242 CDD:238020
fn3 247..328 CDD:278470
fn3 343..417 CDD:278470
fn3 443..525 CDD:278470
FN3 548..611 CDD:238020
FN3 620..706 CDD:238020
fn3 708..796 CDD:278470
fn3 824..886 CDD:278470
fn3 902..978 CDD:278470
fn3 1013..1092 CDD:278470
UP_III_II 1106..>1248 CDD:297589
PTPc 1329..1582 CDD:214550 65/226 (29%)
PTPc 1355..1582 CDD:238006 64/199 (32%)
Y39A3A.4NP_001370800.1 PTPc 51..>256 CDD:214550 68/240 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.