DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44774 and SINHCAF

DIOPT Version :9

Sequence 1:NP_001096880.1 Gene:CG44774 / 31424 FlyBaseID:FBgn0266000 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_011519105.1 Gene:SINHCAF / 58516 HGNCID:30702 Length:328 Species:Homo sapiens


Alignment Length:301 Identity:106/301 - (35%)
Similarity:145/301 - (48%) Gaps:86/301 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFNFHKPRVYRSADGCCICRAKSSSSRFTASRKYEKESMQCFNLNEPRNGEICNACVLLVKRYKR 65
            ||.||||::|||.:|||||||||||||||.|::|||:...||.|:|.|:|:|||||||||||:|:
Human   108 MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKK 172

  Fly    66 LPIGSKRHWGHVVDARAGPGTKSMAKQKKRDNADAKSRAANGSGNSFLPEKFAKNRKSKERAATE 130
            ||.|||::|.|||||||||..|:..|.||         ....|||.....:.:|.:|..:|..::
Human   173 LPAGSKKNWNHVVDARAGPSLKTTLKPKK---------VKTLSGNRIKSNQISKLQKEFKRHNSD 228

  Fly   131 AAAARPSSLSLSTSAVNRPSSTSPTSDHQHSDSNESYDDEQTLPANKPYQTRKRTAAAALATANE 195
            |.         ||:     ||.||.....:  ||:|.|...|..|                    
Human   229 AH---------STT-----SSASPAQSPCY--SNQSDDGSDTEMA-------------------- 257

  Fly   196 SKEPNNKRPKLTGSYRRRQLVPQKNRRSVDNIPFFEENDLV---RLEVCCGVVFQSLSLGSTYYI 257
                       :||.|               .|.|...||.   |.::|||::::. ..|..  :
Human   258 -----------SGSNR---------------TPVFSFLDLTYWKRQKICCGIIYKG-RFGEV--L 293

  Fly   258 IDPELYKPCAKHQRIRHQQMQLQLQHQQAEAVNATPTPTTT 298
            ||..|:|||..:::...::.:.|         ...|.|.:|
Human   294 IDTHLFKPCCSNKKAAAEKPEEQ---------GPEPLPIST 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44774NP_001096880.1 FAM60A 2..269 CDD:292039 101/269 (38%)
SINHCAFXP_011519105.1 FAM60A 109..305 CDD:292039 101/269 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160519
Domainoid 1 1.000 150 1.000 Domainoid score I4403
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008153
OrthoInspector 1 1.000 - - oto88429
orthoMCL 1 0.900 - - OOG6_110635
Panther 1 1.100 - - LDO PTHR13422
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4942
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.