DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44774 and sinhcaf

DIOPT Version :9

Sequence 1:NP_001096880.1 Gene:CG44774 / 31424 FlyBaseID:FBgn0266000 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001020702.1 Gene:sinhcaf / 563991 ZFINID:ZDB-GENE-041210-166 Length:245 Species:Danio rerio


Alignment Length:290 Identity:105/290 - (36%)
Similarity:142/290 - (48%) Gaps:85/290 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFNFHKPRVYRSADGCCICRAKSSSSRFTASRKYEKESMQCFNLNEPRNGEICNACVLLVKRYKR 65
            ||.||||::|||.||||||||||||||||.|::||::...||.|:|.|:|||||||||||||:|:
Zfish     1 MFGFHKPKMYRSLDGCCICRAKSSSSRFTDSKRYERDFQSCFGLSETRSGEICNACVLLVKRWKK 65

  Fly    66 LPIGSKRHWGHVVDARAGPGTKSMAKQKKRDNADAKSRAANGSGNSFLPEKFAKNRKSKERAATE 130
            ||:|||::|.||||||.||..|:..|.||..:...:.|          |.:.::.:|..:|..::
Zfish    66 LPVGSKKNWNHVVDARGGPSLKTTVKSKKVKSLSRRIR----------PSQISRVQKELKRHNSD 120

  Fly   131 AAAARPSSLSLSTSAVNRPSSTSPTSDHQHSDSNESYDDEQTLPANKPYQTRKRTAAAALATANE 195
            |.         ||:     ||.||.....:|:.::...|.:..|                     
Zfish   121 AH---------STT-----SSASPAQSPSYSNQSDEGSDSELTP--------------------- 150

  Fly   196 SKEPNNKRPKLTGSYRRRQLVPQKNRRSVDNIPFFEENDLV---RLEVCCGVVFQSLSLGSTYYI 257
                        ||.|.               |.|...||.   |..||||::::. ..|..  :
Zfish   151 ------------GSARS---------------PVFSFLDLTYWKRQRVCCGIIYKG-RFGEV--L 185

  Fly   258 IDPELYKPCAKHQRIRHQQMQLQLQHQQAE 287
            |||.|||||.       |:.|.|.|.::.|
Zfish   186 IDPHLYKPCC-------QKKQEQEQEEEEE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44774NP_001096880.1 FAM60A 2..269 CDD:292039 99/269 (37%)
sinhcafNP_001020702.1 FAM60A 2..195 CDD:292039 98/267 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596918
Domainoid 1 1.000 159 1.000 Domainoid score I4067
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008153
OrthoInspector 1 1.000 - - oto39439
orthoMCL 1 0.900 - - OOG6_110635
Panther 1 1.100 - - LDO PTHR13422
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4942
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.