DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44774 and sinhcafl

DIOPT Version :9

Sequence 1:NP_001096880.1 Gene:CG44774 / 31424 FlyBaseID:FBgn0266000 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001340846.1 Gene:sinhcafl / 386721 ZFINID:ZDB-GENE-031114-2 Length:216 Species:Danio rerio


Alignment Length:307 Identity:108/307 - (35%)
Similarity:142/307 - (46%) Gaps:105/307 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFNFHKPRVYRSADGCCICRAKSSSSRFTASRKYEKESMQCFNLNEPRNGEICNACVLLVKRYKR 65
            ||.|||.::|||.||||||:.||||||||.|.:||:....||.|:|.|.|:|||||||||||:|:
Zfish     1 MFGFHKSKIYRSNDGCCICKTKSSSSRFTDSSRYEENFRLCFGLSEDRVGDICNACVLLVKRWKK 65

  Fly    66 LPIGSKRHWGHVVDARAGPGTKSMAKQKKRDNADAKSRAANGSGNSFLPEKFAKNRKSKERAATE 130
            ||.|||::|.||||||||||.| :.|.||..|.|.|.::           |..|..|.|      
Zfish    66 LPHGSKKNWNHVVDARAGPGFK-LTKPKKVKNIDGKKKS-----------KLKKLHKFK------ 112

  Fly   131 AAAARPSSLSLSTSAVNRPSSTSPTSDHQHSDSNESYDDEQTLPANKPYQTRKRTAAAALATANE 195
                |.:|.:.||:     ||.||:....||:.::...|.:|                       
Zfish   113 ----RQNSDAHSTT-----SSMSPSQSPSHSNQSDDGSDIET----------------------- 145

  Fly   196 SKEPNNKRPKLTG------SYRRRQLVPQKNRRSVDNIPFFEENDLVRLEVCCGVVFQSLSLGST 254
                ..:||..:|      ||.:||                        :||||:|::. ..|..
Zfish   146 ----KQRRPTPSGFSFLDLSYWKRQ------------------------KVCCGIVYKG-RFGEV 181

  Fly   255 YYIIDPELYKPCAKHQRIRHQQMQLQLQHQQAEAVNATPTPTTTPTV 301
              ||||.|:|||...:|                  .|.||.:.:.|:
Zfish   182 --IIDPRLFKPCCNKKR------------------PALPTSSVSQTL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44774NP_001096880.1 FAM60A 2..269 CDD:292039 102/272 (38%)
sinhcaflNP_001340846.1 FAM60A 2..193 CDD:317762 102/271 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.