DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4041 and yibN

DIOPT Version :10

Sequence 1:NP_572197.4 Gene:CG4041 / 31422 FlyBaseID:FBgn0029736 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_418068.1 Gene:yibN / 948131 ECOCYCID:EG12295 Length:143 Species:Escherichia coli


Alignment Length:111 Identity:24/111 - (21%)
Similarity:47/111 - (42%) Gaps:18/111 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   694 ELKHLQQEQCPRISAKDVQFLLDNSPAELALIDLRSVVEFGRVHVPHSINIPFATVQLGEQRLEA 758
            ::|.:.:.:..|:..|:          :..::|||...:|.:.|:..|||       |....::|
E. coli    36 KVKVITRGEATRLINKE----------DAVVVDLRQRDDFRKGHIAGSIN-------LLPSEIKA 83

  Fly   759 LQVPQLEAQLRGKIVVCVSNIHQHSVEFSHFLVACGVQRTCILHKG 804
            ..|.:||.. :.|.|:.|........|.::.|...|..:..:|.:|
E. coli    84 NNVGELEKH-KDKPVIVVDGSGMQCQEPANALTKAGFAQVFVLKEG 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4041NP_572197.4 Protein Kinases, catalytic domain 48..263 CDD:473864
TBC 432..634 CDD:214540
RHOD_Kc 706..810 CDD:238783 22/99 (22%)
yibNNP_418068.1 PspE 35..143 CDD:440372 24/111 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.